>cd06128 DNA_polA_exo The 3'-5' exonuclease domain of family-A DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity. Family-A DNA polymerases contain a DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-B DNA polymerases. The exonuclease domain contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, which are clustered around the active site and contain four invariant acidic residues that serve as ligands for the two metal ions required for catalysis. The Klenow fragment (KF) of Escherichia coli pol I, the Thermus aquaticus (Taq) pol I, and Bacillus stearothermophilus (BF) pol I are examples of family-A DNA polymerases. They are involved in nucleotide excision repair and in the processing of Okazaki fragments that are generated during lagging strand synthesis. The N-terminal domains of BF pol I and Taq pol I resemble the fold of the 3'-5' exonuclease domain of KF

Probab=100.00 E-value=1.3e-36 Score=285.65 Aligned_cols=162 Identities=30% Similarity=0.498 Sum_probs=149.0 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHH Q ss_conf 68523233222433110012442010257766544345502313744333456500178899997444420222100110 Q gi|254780277|r 387 IGSASFKIITDTMDAFHSKPIAIAISTLDQKDDTSFKVETIFIDLSVHTSQDSTGKNTLTKEILSYLKKFFENEHFLKIG 466 (976) Q Consensus 387 ~~~ia~DtETt~ld~~~~~ivGisls~~~~~~~~~~~~~~~yip~~~~~~~d~~~~~~~~~evl~~L~~lle~~~i~kIg 466 (976) T Consensus 1 a~~~a~DtETt~ld~~~a~iVGis~s~~~~~--------a~YiP~~h~~~~--~~~~l~~~~vl~~L~p~led~~i~Kig 70 (166) T cd06128 1 APVFAFDTETDSLDNISANLVGLSFAIEPGV--------AAYIPVAHDYLD--APDQISRERALELLKPLLEDEKALKVG 70 (166) T ss_pred CCEEEEECCCCCCCCCCCEEEEEEEECCCCE--------EEEEECCCCCCC--CHHHHHHHHHHHHHHHHHCCCCCCEEE T ss_conf 9989997887998904354999999800896--------999952677667--525778999999999997399976453 Q ss_pred CCCCHHHHHHHHCCCCCCCC-CCHHHHHHHHCCCCCCCCHHHHHHHHCCCCC---CCCCCCCCCCCCCHHHCCHHHHHHH Q ss_conf 03212378898618866642-1002345543168766772466776224442---2335654322210000001233332 Q gi|254780277|r 467 HNIKYDKLVLHRYGISMRGF-EDIMLMSYVLDSGRSSHDIASIAQKWLSYTR---KEILKSRKSSIPIDKISDSQVQEHA 542 (976) Q Consensus 467 HN~KfD~~~L~~~GI~l~~i-~DTmlaayLLdp~~~~~~L~~la~~yL~~~~---~e~~~~~k~~~~~~~i~~e~~~~Ya 542 (976) T Consensus 71 hNlK~D~~vL~~~Gi~l~g~~fDTMlaaylldp~~~~h~Ld~La~~~L~~~~i~~~dl~GkGk~q~~f~~v~i~~~~~YA 150 (166) T cd06128 71 QNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYA 150 (166) T ss_pred ECHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHCCCCCEEHHHHHCCCCCCCCCCCCCHHHHHHHH T ss_conf 11566799996199668999845767987628999889969999998399870599983788575893228999999989 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 2211111245677632 Q gi|254780277|r 543 IENSNVILQLWLLLRP 558 (976) Q Consensus 543 a~Da~~t~~L~~~l~~ 558 (976) T Consensus 151 ~eDAd~t~rL~~~l~P 166 (166) T cd06128 151 AEDADVTLQLHLKMWP 166 (166) T ss_pred HHHHHHHHHHHHHHCC T ss_conf 9999999999985389

HHsearch alignment for GI: 254780277 and conserved domain: cd06128