HHsearch alignment for GI: 254780279 and conserved domain: CHL00194

>CHL00194 ycf39 Ycf39; Provisional.
Probab=97.31  E-value=0.002  Score=43.63  Aligned_cols=98  Identities=15%  Similarity=0.284  Sum_probs=61.5

Q ss_pred             EEEEEECC-CHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCC--CCCCCCCCHHHHHCCCCEEEEEECC-
Q ss_conf             37999899-8779999999983899789999964898020455366608754--6754556857852135504763101-
Q gi|254780279|r    6 MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISP--MGIKFSDNLAMAIQSVDGIIDFSSP-   81 (280)
Q Consensus         6 IkV~I~Ga-GkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~--~~v~i~~dl~~~~~~~DViIDFT~P-   81 (280)
T Consensus         1 M~ILV~GATG~lGr~vVr~Ll~-~G~~Vr~l-vRnp~ka--~~l~~-~Gve~v~gDl~dpesl~~Al~GvdaVi~~~~~~   75 (319)
T CHL00194          1 MSLLVIGATGTLGRQIVRRALD-EGYQVKCL-VRNLRKA--AFLKE-WGAELVYGDLSLPETIPPALEGITAIIDASTSR   75 (319)
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCCEEEE-ECCHHHH--HHHHH-CCCEEEEECCCCHHHHHHHHCCCCEEEEECCCC
T ss_conf             9799989985899999999996-88908999-5786763--23421-596799942788778999965996799945667


Q ss_pred             -CH-----------HHHHHHHHHHCCCEEEEEECCCCHH
Q ss_conf             -02-----------4788876432372157650222313
Q gi|254780279|r   82 -AL-----------TLQSLNISAQHNIVHIIGTTGFSVK  108 (280)
Q Consensus        82 -~~-----------~~~~~~~a~~~g~~vViGTTG~~~e  108 (280)
T Consensus        76 ~~~~~~~~~vd~~g~~~li~AAk~aGVkr~V~lS~lga~  114 (319)
T CHL00194         76 PSDLNNAYQIDLEGKLALIEAAKAAKVKRFIFFSILNAE  114 (319)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             788620889889889999999998499889996135666