HHsearch alignment for GI: 254780279 and conserved domain: COG0057

>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].
Probab=98.22  E-value=4.5e-06  Score=61.73  Aligned_cols=194  Identities=17%  Similarity=0.244  Sum_probs=107.8

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCC-CCEEEEEEECCCCHHHC----CC--HHHHCC----------CCCCCCCCCCCHH-
Q ss_conf             737999899877999999998389-97899999648980204----55--366608----------7546754556857-
Q gi|254780279|r    5 PMRISVLGGGRMGQALIKEIHNNP-SITLHSIIVRSGSPLIG----QD--VGNFVG----------ISPMGIKFSDNLA-   66 (280)
Q Consensus         5 ~IkV~I~GaGkMG~~ii~~i~~~~-~~eLv~~i~~~~~~~~g----~d--~~~~~~----------~~~~~v~i~~dl~-   66 (280)
T Consensus         1 ~ikV~INGfGrIGR~v~ra~~~~~~dieVVaInd~t~~~~~A~Llk~Ds~hg~f~~~v~~~~~~~~v~g~~I~v~~~~~p   80 (335)
T COG0057           1 MIKVAINGFGRIGRLVARAALERDGDIEVVAINDLTDPDYLAHLLKYDSVHGRFDGEVEVKDDALVVNGKGIKVLAERDP   80 (335)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCEEEEEECCCH
T ss_conf             90899945757889999999717897599999368997899899864255788777322478748989952688732896


Q ss_pred             HHHCC----CCEEEEEECCCHHHHHHHHHHHCC--CEEEEEECCCCHHHHHHH-----HHHHCCCCCEECCCHHHHHHHH
Q ss_conf             85213----550476310102478887643237--215765022231358999-----8740355521000011568999
Q gi|254780279|r   67 MAIQS----VDGIIDFSSPALTLQSLNISAQHN--IVHIIGTTGFSVKENEVI-----SSFARNAPIVKSSNMSLGINFL  135 (280)
Q Consensus        67 ~~~~~----~DViIDFT~P~~~~~~~~~a~~~g--~~vViGTTG~~~e~~~~l-----~~~s~~~~il~apN~SiGv~ll  135 (280)
T Consensus        81 ~~l~w~d~gvdiVve~Tg~f~~~e~~~~hl~agGaKkV~isap~--~~~~~~vv~gvn~~~~~-~~~~iVsnaSCTTNcL  157 (335)
T COG0057          81 ANLPWADLGVDIVVECTGKFTGREKAEKHLKAGGAKKVLISAPG--KDDVATVVYGVNHNYYD-AGHTIVSNASCTTNCL  157 (335)
T ss_pred             HHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHCCCCEEEECCCC--CCCCCEEEEECCCCCCC-CCCCEEEECCCHHHHH
T ss_conf             87981212863999899876663347999874599789985789--88861799852513357-8884898745113006


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHH----HHCCCCCCC------------------HHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             9999999986115666008999986----416789986------------------789999999985328876422111
Q gi|254780279|r  136 GFLVETAAEYLLPAKDWDFEILEMH----HRRKLDSPS------------------GTALLLGEAIANGRKVNLTDHMVL  193 (280)
Q Consensus       136 ~~l~~~~a~~l~~~~~~dieI~E~H----H~~K~DaPS------------------GTA~~la~~i~~~~~~~~~~~~~~  193 (280)
T Consensus       158 ap~~kvl~d~fGI~~g---~mTtVh~~T~dQ~~~dgph~~~rr~raa~~niIp~sTgaAkav~~VlP~------------  222 (335)
T COG0057         158 APVAKVLNDAFGIEKG---LMTTVHAYTNDQKLVDGPHKDLRRARAAALNIIPTSTGAAKAVGLVLPE------------  222 (335)
T ss_pred             HHHHHHHHHHCCEEEE---EEEEEECCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCHHHHHHHCCC------------
T ss_conf             7879999886094599---9999970159874444765220100123477775787423317664704------------


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCC-CEEEEEEE
Q ss_conf             235767654334565013752882-05799998
Q gi|254780279|r  194 NRHIQQCARTEGSIGIASLRAGSI-VGEHSVVI  225 (280)
Q Consensus       194 ~~~~~~~~~~~~~I~i~s~R~g~~-~g~H~V~f  225 (280)
T Consensus       223 ---------L~GKl~g~A~RVPt~~vs~~dl~v  246 (335)
T COG0057         223 ---------LKGKLTGMAIRVPTPNVSVVDLTV  246 (335)
T ss_pred             ---------CCCCEEEEEEECCCCCCEEEEEEE
T ss_conf             ---------578455689990588727999999