HHsearch alignment for GI: 254780279 and conserved domain: COG0059

>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism].
Probab=90.91  E-value=1.2  Score=24.69  Aligned_cols=180  Identities=16%  Similarity=0.191  Sum_probs=101.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEEC----CC
Q ss_conf             79998998779999999983899789999964898020455366608754675455685785213550476310----10
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSS----PA   82 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~----P~   82 (280)
T Consensus        20 ~iaIIGYGsQG~aha-lNlRDSGlnViiGlr~g~~s--------~~kA~~dGf~V-~~v~ea~k~ADvim~L~PDe~q~~   89 (338)
T COG0059          20 KVAIIGYGSQGHAQA-LNLRDSGLNVIIGLRKGSSS--------WKKAKEDGFKV-YTVEEAAKRADVVMILLPDEQQKE   89 (338)
T ss_pred             EEEEEECCHHHHHHH-HHHHHCCCCEEEEECCCCHH--------HHHHHHCCCEE-ECHHHHHHCCCEEEEECCHHHHHH
T ss_conf             699990270878887-42242487479985688724--------89999669775-139998522799998186546789


Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCCCC-CEECCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             247888764323721576502223135899987403555-2100001156899999999999861156660089999864
Q gi|254780279|r   83 LTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP-IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHH  161 (280)
Q Consensus        83 ~~~~~~~~a~~~g~~vViGTTG~~~e~~~~l~~~s~~~~-il~apN~SiGv~ll~~l~~~~a~~l~~~~~~dieI~E~HH  161 (280)
T Consensus        90 vy~~~I~p~Lk~G~aL~F-aHGfNihf-~~i-~ppkdvdV~MVAPKg-PG~~VR~~-------y~~-G~GvP-~LiAV~q  156 (338)
T COG0059          90 VYEKEIAPNLKEGAALGF-AHGFNIHF-GLI-VPPKDVDVIMVAPKG-PGHLVRRE-------YKE-GFGVP-ALIAVHQ  156 (338)
T ss_pred             HHHHHHHHHHCCCCEEEE-CCCCCEEC-CCC-CCCCCCCEEEECCCC-CCHHHHHH-------HHC-CCCCE-EEEEEEE
T ss_conf             999874345227866776-26553113-303-377667189983899-96789999-------873-69951-6999986


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE---CCCCCEEEEEEEECCCCE
Q ss_conf             1678998678999999998532887642211123576765433456501375---288205799998189958
Q gi|254780279|r  162 RRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLR---AGSIVGEHSVVIAGEGES  231 (280)
Q Consensus       162 ~~K~DaPSGTA~~la~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~I~i~s~R---~g~~~g~H~V~f~~~~E~  231 (280)
T Consensus       157 ----D-~sG~a~~~Ala~AkgiGg~RaG-----------------vieTTFkeEtetDLfGEQ~vLcGgl~~l  207 (338)
T COG0059         157 ----D-ASGKALDIALAYAKGIGGTRAG-----------------VIETTFKEETETDLFGEQAVLCGGLQAL  207 (338)
T ss_pred             ----C-CCCCHHHHHHHHHHHCCCCCCC-----------------EEEEEEHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             ----6-8850999999999761887631-----------------4764208766401111211120079999