HHsearch alignment for GI: 254780279 and conserved domain: COG0569

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism].
Probab=96.37  E-value=0.046  Score=34.25  Aligned_cols=129  Identities=15%  Similarity=0.231  Sum_probs=71.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCC--CCCCCCCCHHHH-HCCCCEEEEEECCC
Q ss_conf             379998998779999999983899789999964898020455366608754--675455685785-21355047631010
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISP--MGIKFSDNLAMA-IQSVDGIIDFSSPA   82 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~--~~v~i~~dl~~~-~~~~DViIDFT~P~   82 (280)
T Consensus         1 m~iiIiG~G~vG~~va~~L~~~-g~~Vv~-Id~d~~~~~~-~~~~~~~~~~v~gd~t~~~~L~~agi~~aD~vva~t~~d   77 (225)
T COG0569           1 MKIIIIGAGRVGRSVARELSEE-GHNVVL-IDRDEERVEE-FLADELDTHVVIGDATDEDVLEEAGIDDADAVVAATGND   77 (225)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCEEEE-EECCHHHHHH-HHHHCCCEEEEEECCCCHHHHHHCCCCCCCEEEEEECCC
T ss_conf             9899989857889999999878-990899-9768899998-632000449999268898999867986389999980886


Q ss_pred             HHHH-HHHHHHH-CCCEEEEEECCCCHHHHHHHHHHHCCCCCEECCCHHHHHHHHHHHHH
Q ss_conf             2478-8876432-37215765022231358999874035552100001156899999999
Q gi|254780279|r   83 LTLQ-SLNISAQ-HNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVE  140 (280)
Q Consensus        83 ~~~~-~~~~a~~-~g~~vViGTTG~~~e~~~~l~~~s~~~~il~apN~SiGv~ll~~l~~  140 (280)
T Consensus        78 ~~N~i~~~la~~~~gv~~viar~~-~~~~~~~~~~~g--~~~ii~Pe~~~~~~l~~~i~~  134 (225)
T COG0569          78 EVNSVLALLALKEFGVPRVIARAR-NPEHEKVLEKLG--ADVIISPEKLAAKRLARLIVT  134 (225)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEC-CCHHHHHHHHCC--CCEEECHHHHHHHHHHHHHCC
T ss_conf             799999999998739984999956-941677898679--948975589999999998538