HHsearch alignment for GI: 254780279 and conserved domain: COG1023

>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism].
Probab=95.90  E-value=0.011  Score=38.54  Aligned_cols=97  Identities=24%  Similarity=0.347  Sum_probs=57.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHH---------CCCHHHHCCC---C-------CCC---CCCCC
Q ss_conf             379998998779999999983899789999964898020---------4553666087---5-------467---54556
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLI---------GQDVGNFVGI---S-------PMG---IKFSD   63 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~---------g~d~~~~~~~---~-------~~~---v~i~~   63 (280)
T Consensus         1 M~iGmiGLGrMG~n~v~rl~-~~ghdvV~-yD~n~~av~~~~~~ga~~a~sl~el~~~L~~pr~vWlMvPag~it~~vi~   78 (300)
T COG1023           1 MQIGMIGLGRMGANLVRRLL-DGGHDVVG-YDVNQTAVEELKDEGATGAASLDELVAKLSAPRIVWLMVPAGDITDAVID   78 (300)
T ss_pred             CCCEEECCCHHHHHHHHHHH-HCCCEEEE-ECCCHHHHHHHHHCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCHHHHHH
T ss_conf             90115400052699999998-38972899-73888999999865775436799999746987479997337773689999


Q ss_pred             CHHHHHCCCCEEEEEEC--CCHHHHHHHHHHHCCCEEEE-EECC
Q ss_conf             85785213550476310--10247888764323721576-5022
Q gi|254780279|r   64 NLAMAIQSVDGIIDFSS--PALTLQSLNISAQHNIVHII-GTTG  104 (280)
Q Consensus        64 dl~~~~~~~DViIDFT~--P~~~~~~~~~a~~~g~~vVi-GTTG  104 (280)
T Consensus        79 ~la~~L~~GDivIDGGNS~y~Ds~rr~~~l~~kgi~flD~GTSG  122 (300)
T COG1023          79 DLAPLLSAGDIVIDGGNSNYKDSLRRAKLLAEKGIHFLDVGTSG  122 (300)
T ss_pred             HHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             98853678888987886325778999998876597178346777