HHsearch alignment for GI: 254780279 and conserved domain: COG1250

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism].
Probab=95.28  E-value=0.085  Score=32.44  Aligned_cols=163  Identities=19%  Similarity=0.228  Sum_probs=81.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCH-HHC-----CCHHHHCCC---C-------CCCCCCCCCHHHH
Q ss_conf             73799989987799999999838997899999648980-204-----553666087---5-------4675455685785
Q gi|254780279|r    5 PMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSP-LIG-----QDVGNFVGI---S-------PMGIKFSDNLAMA   68 (280)
Q Consensus         5 ~IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~-~~g-----~d~~~~~~~---~-------~~~v~i~~dl~~~   68 (280)
T Consensus         3 i~kv~ViGaG~MG~gIA~~~A~-~G~~V~l-~D~~~~~~~~~~~~i~~~l~k~~~~g~l~~~~~~~~l~~i~~~~~~~-~   79 (307)
T COG1250           3 IKKVAVIGAGVMGAGIAAVFAL-AGYDVVL-KDISPEALERALAYIEKNLEKLVEKGKLTEEEADAALARITPTTDLA-A   79 (307)
T ss_pred             CCEEEEECCCCHHHHHHHHHHH-CCCCEEE-EECCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHH-H
T ss_conf             4079997246020999999973-4995699-95898999999999999999888627877455999975152557665-6


Q ss_pred             HCCCCEEEEEEC-------------------------CCHHHHHHHHHHHCCCE-EEEEEC---------------C-CC
Q ss_conf             213550476310-------------------------10247888764323721-576502---------------2-23
Q gi|254780279|r   69 IQSVDGIIDFSS-------------------------PALTLQSLNISAQHNIV-HIIGTT---------------G-FS  106 (280)
Q Consensus        69 ~~~~DViIDFT~-------------------------P~~~~~~~~~a~~~g~~-vViGTT---------------G-~~  106 (280)
T Consensus        80 l~~~DlVIEAv~E~levK~~vf~~l~~~~~~~aIlASNTSsl~it~ia~~~~rper~iG~HFfNP~~~m~LVEvI~g~~T  159 (307)
T COG1250          80 LKDADLVIEAVVEDLELKKQVFAELEALAKPDAILASNTSSLSITELAEALKRPERFIGLHFFNPVPLMPLVEVIRGEKT  159 (307)
T ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCHHEEEEECCCCCCCCEEEEEECCCCC
T ss_conf             63088788853015999999999988655988578622677878999987379323798752698771105888168878


Q ss_pred             -HHHHHHHHHHHCC---CCCEE--CCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCCCHHH
Q ss_conf             -1358999874035---55210--000115689999999999986115666008999986416789986789
Q gi|254780279|r  107 -VKENEVISSFARN---APIVK--SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTA  172 (280)
Q Consensus       107 -~e~~~~l~~~s~~---~~il~--apN~SiGv~ll~~l~~~~a~~l~~~~~~dieI~E~HH~~K~DaPSGTA  172 (280)
T Consensus       160 ~~e~~~~~~~~~~~igK~~vv~~D~pGFi~N-Ril~~~~~eA~~l~~e-Gva~~e~ID~~~~~~~G~pmGpf  229 (307)
T COG1250         160 SDETVERVVEFAKKIGKTPVVVKDVPGFIVN-RLLAALLNEAIRLLEE-GVATPEEIDAAMRQGLGLPMGPF  229 (307)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEECCCCCEEHH-HHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHCCCCCCCHH
T ss_conf             9999999999999859988742678861257-7789999999999980-89999999999986369976588