HHsearch alignment for GI: 254780279 and conserved domain: COG5495

>COG5495 Uncharacterized conserved protein [Function unknown].
Probab=95.53  E-value=0.053  Score=33.84  Aligned_cols=116  Identities=15%  Similarity=0.208  Sum_probs=71.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEECCCH
Q ss_conf             87379998998779999999983899789999964898020455366608754675455685785213550476310102
Q gi|254780279|r    4 SPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPAL   83 (280)
Q Consensus         4 ~~IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~P~~   83 (280)
T Consensus         9 a~~~v~~igtGrl~ra~~~ra-~h~~~~cs~i~srS~--~~a~~LaE~~~a~p~d~~~~ae------l~~~vf-v~vpd~   78 (289)
T COG5495           9 ARVVVGIVGTGRLGRAALLRA-DHVVVACSAISSRSR--DRAQNLAETYVAPPLDVAKSAE------LLLLVF-VDVPDA   78 (289)
T ss_pred             CEEEEEEEECCHHHHHHHHHH-HHHHEEEHHHHHCCH--HHHHHHHHHCCCCCCCHHHCHH------HHCEEE-ECCCHH
T ss_conf             015888760442789999874-003212113432178--9986204421799510120734------515478-626088


Q ss_pred             H-HHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCC--CCCEECCCHHHH
Q ss_conf             4-78887643237215765022231358999874035--552100001156
Q gi|254780279|r   84 T-LQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN--APIVKSSNMSLG  131 (280)
Q Consensus        84 ~-~~~~~~a~~~g~~vViGTTG~~~e~~~~l~~~s~~--~~il~apN~SiG  131 (280)
T Consensus        79 ~~~~vaa~~~~rpg~iv~HcSga~~~--~il~~~gr~g~~~asiHP~f~Fs  127 (289)
T COG5495          79 LYSGVAATSLNRPGTIVAHCSGANGS--GILAPLGRQGCIPASIHPAFSFS  127 (289)
T ss_pred             HHHHHHHHCCCCCCEEEEECCCCCCH--HHHHHHHHCCCCCCEECCCHHCC
T ss_conf             88888876046898389974688740--45425421587530005211036