HHsearch alignment for GI: 254780279 and conserved domain: KOG0069

>KOG0069 consensus.
Probab=94.00  E-value=0.4  Score=27.84  Aligned_cols=61  Identities=18%  Similarity=0.231  Sum_probs=31.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEE
Q ss_conf             799989987799999999838997899999648980204553666087546754556857852135504763
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDF   78 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDF   78 (280)
T Consensus       164 ~vgilG~G~IG~~ia~rL~~Fg-~~i~y~-~r~~~~--~~~~~~-~~~-----~-~~d~~~~~~~sD~ivv~  224 (336)
T KOG0069         164 TVGILGLGRIGKAIAKRLKPFG-CVILYH-SRTQLP--PEEAYE-YYA-----E-FVDIEELLANSDVIVVN  224 (336)
T ss_pred             EEEEECCCHHHHHHHHHHHHCC-CEEEEE-CCCCCC--HHHHHH-HCC-----C-CCCHHHHHHHCCEEEEE
T ss_conf             7999627478899999635326-625541-135776--366887-435-----4-36788887328879992