HHsearch alignment for GI: 254780279 and conserved domain: KOG1494

>KOG1494 consensus.
Probab=93.61  E-value=0.12  Score=31.36  Aligned_cols=73  Identities=23%  Similarity=0.398  Sum_probs=55.1

Q ss_pred             CCEEEEEECC-CHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCC-CCCCCCCCHHHHHCCCCEEE
Q ss_conf             8737999899-8779999999983899789999964898020455366608754-67545568578521355047
Q gi|254780279|r    4 SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISP-MGIKFSDNLAMAIQSVDGII   76 (280)
Q Consensus         4 ~~IkV~I~Ga-GkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~-~~v~i~~dl~~~~~~~DViI   76 (280)
T Consensus        27 ~~~KVAvlGAaGGIGQPLSLLlK~np~Vs~LaLYDi~~~~GVaaDlSHI~T~s~V~g~~g~~~L~~al~~advVv  101 (345)
T KOG1494          27 RGLKVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIANTPGVAADLSHINTNSSVVGFTGADGLENALKGADVVV  101 (345)
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHCCCCEEE
T ss_conf             762499973487667568999742855230133320369862022001678871312678367898753897899