HHsearch alignment for GI: 254780279 and conserved domain: KOG2304

>KOG2304 consensus.
Probab=90.54  E-value=0.19  Score=30.09  Aligned_cols=35  Identities=11%  Similarity=0.475  Sum_probs=23.7

Q ss_pred             CE-EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             73-79998998779999999983899789999964898
Q gi|254780279|r    5 PM-RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGS   41 (280)
Q Consensus         5 ~I-kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~   41 (280)
T Consensus        10 ~~~~V~ivGaG~MGSGIAQ-v~a~sg~~V-~l~d~~~~   45 (298)
T KOG2304          10 EIKNVAIVGAGQMGSGIAQ-VAATSGLNV-WLVDANED   45 (298)
T ss_pred             CCCCEEEECCCCCCHHHHH-HHHHCCCCE-EEECCCHH
T ss_conf             5662478756643203999-988519946-98547778