HHsearch alignment for GI: 254780279 and conserved domain: KOG2653

>KOG2653 consensus.
Probab=90.36  E-value=1.3  Score=24.28  Aligned_cols=40  Identities=33%  Similarity=0.411  Sum_probs=28.9

Q ss_pred             CCCC-CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCH
Q ss_conf             9988-73799989987799999999838997899999648980
Q gi|254780279|r    1 MHQS-PMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSP   42 (280)
Q Consensus         1 M~~~-~IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~   42 (280)
T Consensus         1 m~q~~~~digLiGLaVMGqnLiLN~-~d~Gf~v~-~yNRT~sk   41 (487)
T KOG2653           1 MSQTPKADIGLIGLAVMGQNLILNI-ADKGFTVC-AYNRTTSK   41 (487)
T ss_pred             CCCCCCCCEEEHHHHHHHHHHHCCC-CCCCCEEE-EECCCHHH
T ss_conf             9977644100011665024552001-04683589-86461476