HHsearch alignment for GI: 254780279 and conserved domain: KOG4354

>KOG4354 consensus.
Probab=93.59  E-value=0.33  Score=28.38  Aligned_cols=130  Identities=18%  Similarity=0.283  Sum_probs=66.4

Q ss_pred             CCCCEEEEEECC-CHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCC-CCCCHHHHHC-C-CCEEEE
Q ss_conf             988737999899-87799999999838997899999648980204553666087546754-5568578521-3-550476
Q gi|254780279|r    2 HQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK-FSDNLAMAIQ-S-VDGIID   77 (280)
Q Consensus         2 ~~~~IkV~I~Ga-GkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~-i~~dl~~~~~-~-~DViID   77 (280)
T Consensus        16 ~~k~~rv~LlGArGYTGknlv~Lin~HPylevthvssre---l~Gqkl~~ytk~eiqy~~lst~D~~klee~~avd~wv-   91 (340)
T KOG4354          16 PEKDIRVGLLGARGYTGKNLVRLINNHPYLEVTHVSSRE---LAGQKLEVYTKLEIQYADLSTVDAVKLEEPHAVDHWV-   91 (340)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHCCCCCEEEEEEEHHH---HCCCCCCCCCHHHEEECCCCHHHHHHHHCCCCEEEEE-
T ss_conf             689825998733665416699886389736888632254---3477156743221232344246678762577645566-


Q ss_pred             EECCCHHHH-HHHHH-HHCCCEEEEEEC-------------CCCHH-HHHHHHHHHCC-CCCEECCCHHHHHHHH
Q ss_conf             310102478-88764-323721576502-------------22313-58999874035-5521000011568999
Q gi|254780279|r   78 FSSPALTLQ-SLNIS-AQHNIVHIIGTT-------------GFSVK-ENEVISSFARN-APIVKSSNMSLGINFL  135 (280)
Q Consensus        78 FT~P~~~~~-~~~~a-~~~g~~vViGTT-------------G~~~e-~~~~l~~~s~~-~~il~apN~SiGv~ll  135 (280)
T Consensus        92 maLPn~vckpfv~~~~s~~gks~iidlsad~rf~p~~~w~YGLpElndRe~i~na~~iaNPGCYaTgsQl~l~Pl  166 (340)
T KOG4354          92 MALPNQVCKPFVSLTESSDGKSRIIDLSADWRFQPHKEWVYGLPELNDREDIKNARLIANPGCYATGSQLPLVPL  166 (340)
T ss_pred             EECCHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCHHEEECCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHH
T ss_conf             525415678888887623771466311033347754020106710043888754040269973245672564477