HHsearch alignment for GI: 254780279 and conserved domain: PRK03815

>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=94.65  E-value=0.16  Score=30.64  Aligned_cols=111  Identities=19%  Similarity=0.223  Sum_probs=52.4

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEECCCHHH
Q ss_conf             37999899877999999998389978999996489802045536660875467545568578521355047631010247
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTL   85 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~P~~~~   85 (280)
T Consensus         1 mKi~V~GlG~sG~s~a~~L~~~g~~--~i~dD~~~~~~~~-~~~~---------~~~~~~~~~~~~~d~vv--~SPGI~~   66 (401)
T PRK03815          1 MKISLFGYGKTTKALARFFVKNGGV--DIYDDKFTEPKKD-EEGN---------LLLPSNDFDPNKSDLEI--PSPGIPP   66 (401)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCE--EEEECCCCCCCHH-HHHC---------CCCCHHHCCCHHCCEEE--ECCCCCC
T ss_conf             9399984777189999999948797--9998999862224-6404---------00684335801286899--8998599


Q ss_pred             --HH----------HHHHHHCC--CEEEEEECCCCHHHHHHHHHHHCCCCCEECCCHHHH
Q ss_conf             --88----------87643237--215765022231358999874035552100001156
Q gi|254780279|r   86 --QS----------LNISAQHN--IVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLG  131 (280)
Q Consensus        86 --~~----------~~~a~~~g--~~vViGTTG~~~e~~~~l~~~s~~~~il~apN~SiG  131 (280)
T Consensus        67 ~~p~~~~a~~i~seiel~~~~~~~~I~ITGTNGKsTt-t~li~~iL~~~g~~~~GNIG~P  125 (401)
T PRK03815         67 SHPLIQKAKNLISEYDYFYSFMPFSIWISGTNGKTTT-TQMLTHLLEDFGAVSGGNIGTP  125 (401)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHH-HHHHHHHHHHCCCCEECCCCHH
T ss_conf             8799998745414999998527874899847777899-9999999986698130416643