HHsearch alignment for GI: 254780279 and conserved domain: PRK04308

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=93.78  E-value=0.27  Score=28.98  Aligned_cols=75  Identities=17%  Similarity=0.132  Sum_probs=39.8

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCC--CCHHHHHCCCCEEEEE
Q ss_conf             99887379998998779999999983899789999964898020455366608754675455--6857852135504763
Q gi|254780279|r    1 MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS--DNLAMAIQSVDGIIDF   78 (280)
Q Consensus         1 M~~~~IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~--~dl~~~~~~~DViIDF   78 (280)
T Consensus         1 m~~~~k~v~viGlG~sG~s~a~~L~-~~G~~v~~-~D~~~~~~---~~~~~~~~-~~~i~~~~g~~~~~~~~~~d~vV--   72 (445)
T PRK04308          1 MTFQNKKILVAGLGGTGISMIAYLR-KNGAEVAA-YDAELKAE---RVAQIGKM-FDGLVFYTGRLKDALDNGFDILA--   72 (445)
T ss_pred             CCCCCCEEEEEEECHHHHHHHHHHH-HCCCEEEE-EECCCCCC---HHHHHHHC-CCCCEEEECCCHHHHCCCCCEEE--
T ss_conf             9979998999998999999999999-78991999-97999953---18999743-69968993786365015999999--


Q ss_pred             ECCCH
Q ss_conf             10102
Q gi|254780279|r   79 SSPAL   83 (280)
Q Consensus        79 T~P~~   83 (280)
T Consensus        73 ~SPgI   77 (445)
T PRK04308         73 LSPGI   77 (445)
T ss_pred             ECCCC
T ss_conf             89953