HHsearch alignment for GI: 254780279 and conserved domain: PRK04663

>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=95.39  E-value=0.097  Score=32.06  Aligned_cols=118  Identities=16%  Similarity=0.294  Sum_probs=58.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC-CCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCC--CCCHHHHHCCCCEEEEEECCCH
Q ss_conf             7999899877999999998389-978999996489802045536660875467545--5685785213550476310102
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNP-SITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF--SDNLAMAIQSVDGIIDFSSPAL   83 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~-~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i--~~dl~~~~~~~DViIDFT~P~~   83 (280)
T Consensus         9 kvlV~GlG~sG~s~a~~L~~~~~~~~v-~~~D~~~~~~~~~~l~-------~~~~~~~g~~~~~~l~~~d~vV--~SPGI   78 (438)
T PRK04663          9 NVVVVGLGITGLSVVKHLRKTQPQLTV-KVIDTRETPPGQEQLP-------EDVELHSGGWNQDWLAEADLVV--TNPGI   78 (438)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCCCEE-EEECCCCCHHHHHHHH-------CCCEEEECCCCHHHHCCCCEEE--ECCCC
T ss_conf             499990678589999999966998469-9963988936887620-------6976972788967836899999--89976


Q ss_pred             H--HHHHHHHHHCCCEE--------------EEEECCCCHHH--HHHHHHHHCC--CCCEECCCHHHHHHHHH
Q ss_conf             4--78887643237215--------------76502223135--8999874035--55210000115689999
Q gi|254780279|r   84 T--LQSLNISAQHNIVH--------------IIGTTGFSVKE--NEVISSFARN--APIVKSSNMSLGINFLG  136 (280)
Q Consensus        84 ~--~~~~~~a~~~g~~v--------------ViGTTG~~~e~--~~~l~~~s~~--~~il~apN~SiGv~ll~  136 (280)
T Consensus        79 ~~~~p~~~~a~~~~i~i~~eiel~~~~~~~~iIaVTGTnGKTTTtsli~~iL~~~g~~~~~gGNi--G~p~~~  149 (438)
T PRK04663         79 ALATPEIQPVLAKGIPVVGDIELFAWAVDKPVIAITGSNGKSTVTDLTGVMAKAAGVKVAVGGNI--GVPALD  149 (438)
T ss_pred             CCCCHHHHHHHHCCCCEECHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEEC--CCHHHH
T ss_conf             99898999999869937038899976458978999489982899999999998289970687215--716887