HHsearch alignment for GI: 254780279 and conserved domain: PRK06407

>PRK06407 ornithine cyclodeaminase; Provisional.
Probab=95.45  E-value=0.037  Score=34.91  Aligned_cols=95  Identities=12%  Similarity=0.067  Sum_probs=63.8

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCC-CCCCCCCCCCHHHHHCCCCEEEEEECCCHH
Q ss_conf             3799989987799999999838997899999648980204553666087-546754556857852135504763101024
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGI-SPMGIKFSDNLAMAIQSVDGIIDFSSPALT   84 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~-~~~~v~i~~dl~~~~~~~DViIDFT~P~~~   84 (280)
T Consensus       119 ~~l~iiG~G~QA~~~~~a~~~v~~i~~v~v~~r~~~~a~--~f~~~~~~~~~~~v~~~~~~e~av~~aDiI~taT~-s~~  195 (302)
T PRK06407        119 ENFTIIGSGFQAETQLEGMASVYNPKRIRVYSRNFDHAR--AFAERFSKEFGVDIRPVDNAEAALRDADTITSITN-SDT  195 (302)
T ss_pred             CEEEEEEEHHHHHHHHHHHHHHCCCCEEEEEECCHHHHH--HHHHHHHHHCCCCEEEECCHHHHHHHCCEEEEECC-CCC
T ss_conf             789999665999999999997407738999808889999--99999864409957994899999834999999418-988


Q ss_pred             HHHHHHHHHCCCEEEE-EEC
Q ss_conf             7888764323721576-502
Q gi|254780279|r   85 LQSLNISAQHNIVHII-GTT  103 (280)
Q Consensus        85 ~~~~~~a~~~g~~vVi-GTT  103 (280)
T Consensus       196 Pv~~~~~l~~g~hi~aiGa~  215 (302)
T PRK06407        196 PIFNRKYLGDEYHVNLAGSN  215 (302)
T ss_pred             CCCCHHHCCCCCEEEEECCC
T ss_conf             67158887999489963799