HHsearch alignment for GI: 254780279 and conserved domain: PRK06598

>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed.
Probab=97.43  E-value=0.001  Score=45.59  Aligned_cols=119  Identities=15%  Similarity=0.186  Sum_probs=73.4

Q ss_pred             CEEEEEECC-CHHHHHHHHHHHHC--CCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             737999899-87799999999838--997899999648980204553666087546754556857852135504763101
Q gi|254780279|r    5 PMRISVLGG-GRMGQALIKEIHNN--PSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSP   81 (280)
Q Consensus         5 ~IkV~I~Ga-GkMG~~ii~~i~~~--~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~P   81 (280)
T Consensus         2 m~kVaIvGATG~vG~eli~lL~~~~~p~~~i~~~aS~~s---~G~~~~-~~~---~~~~~~~~~~~~~~~~Di~f-~a~~   73 (348)
T PRK06598          2 MYNVGVVGATGMVGSVLLQMLEERDFPVIEPVFFASSRS---GGKAPS-FGG---KTLLVDALDIEDLKGLDIAL-FSAG   73 (348)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCC---CCCCCE-ECC---CEEEEEECCHHHHHCCCEEE-ECCC
T ss_conf             847999898459999999999867999624999987566---898750-689---55478627855760799999-8688


Q ss_pred             -CHHHHHHHHHHHCCCEEEEEECCCC----------HHHHHHHHHHHCCCCCEECCCHHHHH
Q ss_conf             -0247888764323721576502223----------13589998740355521000011568
Q gi|254780279|r   82 -ALTLQSLNISAQHNIVHIIGTTGFS----------VKENEVISSFARNAPIVKSSNMSLGI  132 (280)
Q Consensus        82 -~~~~~~~~~a~~~g~~vViGTTG~~----------~e~~~~l~~~s~~~~il~apN~SiGv  132 (280)
T Consensus        74 ~~~s~~~~~~~~~~g~~VIDlSs~fR~~~~vplvvPEiN~~~i~~~~-~~~iIAnPgC~~t~  134 (348)
T PRK06598         74 GDYSKEVAPKLRAAGGVVIDNASALRMDPDVPLVVPEVNPDAIKDAL-KKGIIANPNCTTSL  134 (348)
T ss_pred             CHHHHHHHHHHHHCCCEEEECCHHHCCCCCCEEECCCCCHHHHHHCC-CCCCEECCCCHHHH
T ss_conf             23568888999758989998864310368843764620789997341-36822388819999