HHsearch alignment for GI: 254780279 and conserved domain: PRK06728

>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional.
Probab=98.18  E-value=8e-06  Score=60.02  Aligned_cols=125  Identities=16%  Similarity=0.227  Sum_probs=81.8

Q ss_pred             CCCCCEEEEEECC-CHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEE
Q ss_conf             9988737999899-877999999998389978999996489802045536660875467545568578521355047631
Q gi|254780279|r    1 MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFS   79 (280)
Q Consensus         1 M~~~~IkV~I~Ga-GkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT   79 (280)
T Consensus         1 m~~k~~nVaIvGATG~VG~~li~lL~~h~~f~v~~v~~~aS~~saGk~v~----~~~~~~~v~~~~~~~~~~~Divf~a~   76 (347)
T PRK06728          1 MSEKGYHVAVVGATGAVGQKIIELLEKETKFNIAEVTLLSSKRSAGKTVQ----FKGREIIIQEAKINSFEGVDIAFFSA   76 (347)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCEE----ECCCEEEEEECCHHHHHCCCEEEECC
T ss_conf             99888779999880399999999997278987510799865877997626----89927899857844651697899768


Q ss_pred             CCCHHHHHHHHHHHCCCEEEEEECCCCHHH----------HHHHHHHHCCCCCEECCCHHHHH
Q ss_conf             010247888764323721576502223135----------89998740355521000011568
Q gi|254780279|r   80 SPALTLQSLNISAQHNIVHIIGTTGFSVKE----------NEVISSFARNAPIVKSSNMSLGI  132 (280)
Q Consensus        80 ~P~~~~~~~~~a~~~g~~vViGTTG~~~e~----------~~~l~~~s~~~~il~apN~SiGv  132 (280)
T Consensus        77 ~~~~s~~~~~~~~~~G~~VID~Ssa~R~~~~vPlvvPEvN~~~l~---~~~~iIanPnC~tt~  136 (347)
T PRK06728         77 GGEVSRQFVNQAVSSGAIVIDNTSEYRMAHDVPLVVPEVNAHTLK---EHKGIIAVPNCSALQ  136 (347)
T ss_pred             CHHHHHHHHHHHHHCCCEEEECCHHHCCCCCCCEECCCCCHHHHH---CCCCEEECCCHHHHH
T ss_conf             578899999999858969998975656899974588752966762---327837789808889