HHsearch alignment for GI: 254780279 and conserved domain: PRK06928

>PRK06928 pyrroline-5-carboxylate reductase; Reviewed.
Probab=98.07  E-value=5.6e-05  Score=54.21  Aligned_cols=117  Identities=13%  Similarity=0.114  Sum_probs=73.3

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCE--EEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEECCCH
Q ss_conf             37999899877999999998389978--9999964898020455366608754675455685785213550476310102
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSIT--LHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPAL   83 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~e--Lv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~P~~   83 (280)
T Consensus         2 ~kI~fIG~GnMg~Aii~Gll~~~~~~~~~i~v~~~~~~~~~----~~~~--~~~~~~~~~~~~~~~~~~dvIilaVKP~~   75 (275)
T PRK06928          2 EKIGFIGYGSMADMIATKLLETEVITPEEIILYSRSENEHF----KQLY--DKYPTVALASNEELFTKCDHSFICVPPLA   75 (275)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHH----HHHH--HHCCCEEECCHHHHHHHCCEEEEEECHHH
T ss_conf             88999867899999999999789999636999789938999----9999--87495363777999854998999978587


Q ss_pred             HHHHHHHHH---HCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEC-CCHHHHH
Q ss_conf             478887643---237215765022231358999874035552100-0011568
Q gi|254780279|r   84 TLQSLNISA---QHNIVHIIGTTGFSVKENEVISSFARNAPIVKS-SNMSLGI  132 (280)
Q Consensus        84 ~~~~~~~a~---~~g~~vViGTTG~~~e~~~~l~~~s~~~~il~a-pN~SiGv  132 (280)
T Consensus        76 ~~~vl~~i~~~~~~~~~iISi~AGi~i~~l~~~---~~-~~vvRvMPNtpa~v  124 (275)
T PRK06928         76 VLPLMKDCAPVLTPDRHVVSIAAGVSLDDLLEI---TP-GQVSRLIPSLTSAV  124 (275)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHH---CC-CCEEEEECCCCHHH
T ss_conf             999999976532799689995699989999975---79-98379713732776