HHsearch alignment for GI: 254780279 and conserved domain: PRK07403

>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed.
Probab=97.71  E-value=0.00013  Score=51.77  Aligned_cols=139  Identities=18%  Similarity=0.156  Sum_probs=72.5

Q ss_pred             CEEEEEECCCHHHHHHHHHHH--HCCCCEEEEEEECCCCHHH----------CCCHHH--------HCCCCCCCCCCCCC
Q ss_conf             737999899877999999998--3899789999964898020----------455366--------60875467545568
Q gi|254780279|r    5 PMRISVLGGGRMGQALIKEIH--NNPSITLHSIIVRSGSPLI----------GQDVGN--------FVGISPMGIKFSDN   64 (280)
Q Consensus         5 ~IkV~I~GaGkMG~~ii~~i~--~~~~~eLv~~i~~~~~~~~----------g~d~~~--------~~~~~~~~v~i~~d   64 (280)
T Consensus         1 MikIgINGFGRIGR~vlR~~~~~~~~~ieiVaINd~~d~~~~ayLlkyDS~hG~~~~~v~~~~~~l~v~g~~I~~~~~~~   80 (337)
T PRK07403          1 MIRVAINGFGRIGRNFLRCWLGRENSQLELVAINDTSDPRTNAHLLKYDSMLGKLNADISADENSITVNGKTIKCVSDRN   80 (337)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHCCCCCCCCCCCCEEECCCEEEECCEEEEEEECCC
T ss_conf             90999968887899999999856699869999847998899999867147899989858971998999998878880599


Q ss_pred             HHHHH---CCCCEEEEEECCCHHHHHHHHHHHCCCEEEEEE-CCCCHHHHHH------HHHHH-CCCCCEECCCHHHHHH
Q ss_conf             57852---135504763101024788876432372157650-2223135899------98740-3555210000115689
Q gi|254780279|r   65 LAMAI---QSVDGIIDFSSPALTLQSLNISAQHNIVHIIGT-TGFSVKENEV------ISSFA-RNAPIVKSSNMSLGIN  133 (280)
Q Consensus        65 l~~~~---~~~DViIDFT~P~~~~~~~~~a~~~g~~vViGT-TG~~~e~~~~------l~~~s-~~~~il~apN~SiGv~  133 (280)
T Consensus        81 p~~i~W~~~gvDiViEcTG~f~~~~~a~~Hl~~GakkViiSAP~k~~d-~~tiV~GVN~~~~~~~~h~II--S~aSCTTN  157 (337)
T PRK07403         81 PLNLPWAEWGIDLIIESTGVFVTKEGASKHIQAGAKKVLITAPGKGEG-IGTYVVGVNHHEYDHEDYNII--SNASCTTN  157 (337)
T ss_pred             HHHCCHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCCCC-CCEEEEECCHHHCCCCCCEEE--ECCCHHHH
T ss_conf             666980130998999898654877889998756986799806998887-666998426355375444189--73625876


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999861
Q gi|254780279|r  134 FLGFLVETAAEYL  146 (280)
Q Consensus       134 ll~~l~~~~a~~l  146 (280)
T Consensus       158 clAPv~kvL~~~f  170 (337)
T PRK07403        158 CLAPIAKVIHDNF  170 (337)
T ss_pred             HHHHHHHHHHHHC
T ss_conf             6888999887515