HHsearch alignment for GI: 254780279 and conserved domain: PRK07688

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated.
Probab=97.14  E-value=0.0023  Score=43.24  Aligned_cols=100  Identities=19%  Similarity=0.236  Sum_probs=63.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCC---------CHHHCCCHHHH----------CCCCCCCCCC-----
Q ss_conf             37999899877999999998389978999996489---------80204553666----------0875467545-----
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSG---------SPLIGQDVGNF----------VGISPMGIKF-----   61 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~---------~~~~g~d~~~~----------~~~~~~~v~i-----   61 (280)
T Consensus        25 a~VlVvGaGGLGs~~a~~La~a-GVG~i~ivD~D~Ve~SNL~RQ~L~~e~Dig~~~pKa~aA~~~L~~iNp~v~I~~~~~  103 (339)
T PRK07688         25 KHVLIIGAGALGTANAEMLVRA-GVGKVTIVDRDYVEWSNLQRQQLYTESDVKNNLPKAVAAKKRLEEINSEVRVEAIVQ  103 (339)
T ss_pred             CCEEEECCCHHHHHHHHHHHHC-CCCEEEEEECCEECCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             9789987777779999999984-898299980999246678865065621332263779999999983499860587600


Q ss_pred             ---CCCHHHHHCCCCEEEEEE-CCCHHHHHHHHHHHCCCEEEEEE-CCCC
Q ss_conf             ---568578521355047631-01024788876432372157650-2223
Q gi|254780279|r   62 ---SDNLAMAIQSVDGIIDFS-SPALTLQSLNISAQHNIVHIIGT-TGFS  106 (280)
Q Consensus        62 ---~~dl~~~~~~~DViIDFT-~P~~~~~~~~~a~~~g~~vViGT-TG~~  106 (280)
T Consensus       104 ~l~~~n~~~li~~~DlViD~tDNf~tR~liNd~c~~~~~PlV~ga~~g~~  153 (339)
T PRK07688        104 DVTAEELEELVTNVDVIIDATDNFETRFIVNDAAQKYSIPWIYGACVGSY  153 (339)
T ss_pred             CCCHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEECCE
T ss_conf             39989999998518899987889999999999999959998999884468