HHsearch alignment for GI: 254780279 and conserved domain: PRK08293

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated.
Probab=97.34  E-value=0.0021  Score=43.38  Aligned_cols=101  Identities=17%  Similarity=0.243  Sum_probs=53.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHH-C-----CCHHHHC---CCC--------CCCCCCCCCHHHHH
Q ss_conf             79998998779999999983899789999964898020-4-----5536660---875--------46754556857852
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLI-G-----QDVGNFV---GIS--------PMGIKFSDNLAMAI   69 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~-g-----~d~~~~~---~~~--------~~~v~i~~dl~~~~   69 (280)
T Consensus         5 ~VaViGaG~MG~gIA~~~a~-~G~~V~-l~D~~~~~l~~a~~~i~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~dl~~a~   82 (288)
T PRK08293          5 KVTVAGAGVLGSQIAFQTAF-KGFDVT-IYDISEEALDAAKRRLAKLADRYVRDLHLTDEAFAAAAKNRITFTTDLAQAV   82 (288)
T ss_pred             EEEEECCCHHHHHHHHHHHH-CCCCEE-EEECCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCHHHHH
T ss_conf             89998978899999999995-799289-9989889999999999999999997059991789999980773058989984


Q ss_pred             CCCCEEEEEECCCH-----HHHHHHHHHHCCCEEEEEECCCCHHH
Q ss_conf             13550476310102-----47888764323721576502223135
Q gi|254780279|r   70 QSVDGIIDFSSPAL-----TLQSLNISAQHNIVHIIGTTGFSVKE  109 (280)
Q Consensus        70 ~~~DViIDFT~P~~-----~~~~~~~a~~~g~~vViGTTG~~~e~  109 (280)
T Consensus        83 ~~aDlViEav~E~l~iK~~lf~~le~~~~~~~IlaSNTSsl~it~  127 (288)
T PRK08293         83 KDADLVIEAVPEDPEIKGDFYEQLAEVAPEKTIFATNSSTLLPSQ  127 (288)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
T ss_conf             669999997808799999999999974677669986687676579