HHsearch alignment for GI: 254780279 and conserved domain: PRK08306

>PRK08306 dipicolinate synthase subunit A; Reviewed.
Probab=91.32  E-value=0.68  Score=26.28  Aligned_cols=57  Identities=26%  Similarity=0.343  Sum_probs=29.3

Q ss_pred             CEEEEEECC-CHHHHHHHHHHHHCCCCEEE-EEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEE
Q ss_conf             737999899-87799999999838997899-9996489802045536660875467545568578521355047
Q gi|254780279|r    5 PMRISVLGG-GRMGQALIKEIHNNPSITLH-SIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGII   76 (280)
Q Consensus         5 ~IkV~I~Ga-GkMG~~ii~~i~~~~~~eLv-~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViI   76 (280)
T Consensus         2 g~~iaviGGD~Rq-~~l~~~L~~~-g~~V~~~gf~~~~~-------------~~~~~~~~~~~~~~~~~~d~iI   60 (296)
T PRK08306          2 GMHIAVIGGDARQ-LELIRKLVEL-GAKVSLVGFDQLDH-------------GFTGVAKCSSLEEALSDVDVII   60 (296)
T ss_pred             CCEEEEECCCHHH-HHHHHHHHHC-CCEEEEEECCCCCC-------------CCCCEEEECCHHHHHHCCCEEE
T ss_conf             9489997875899-9999999977-99799983576555-------------6676177346788872399999