HHsearch alignment for GI: 254780279 and conserved domain: PRK08605

>PRK08605 D-lactate dehydrogenase; Validated.
Probab=94.69  E-value=0.41  Score=27.80  Aligned_cols=102  Identities=15%  Similarity=0.164  Sum_probs=74.8

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEECCCHH
Q ss_conf             73799989987799999999838997899999648980204553666087546754556857852135504763101024
Q gi|254780279|r    5 PMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALT   84 (280)
Q Consensus         5 ~IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~P~~~   84 (280)
T Consensus         1 m~Ki~~~~~~~~e~~~~~~~~~~~~~ev~~~~~----------------------~~~ee~i~~~~~~D~i~v~~~~~i~   58 (332)
T PRK08605          1 MTKIKLMSVRDEDAPYIKAWAEKHHVEVDLTKE----------------------ALTDDNVEEVEGFDGLSLSQQIPLS   58 (332)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECC----------------------CCCHHHHHHHCCCCEEEEECCCCCC
T ss_conf             976999827665699999988865907999669----------------------9998999985799889997079779


Q ss_pred             HHHHHHHHHCCCEEEE-EECCCCHHHHHHHHHHHCCCCCEECCCHHH
Q ss_conf             7888764323721576-502223135899987403555210000115
Q gi|254780279|r   85 LQSLNISAQHNIVHII-GTTGFSVKENEVISSFARNAPIVKSSNMSL  130 (280)
Q Consensus        85 ~~~~~~a~~~g~~vVi-GTTG~~~e~~~~l~~~s~~~~il~apN~Si  130 (280)
T Consensus        59 ~~vl~~~~~l~iK~I~r~gvG~DnIDl~~a~~--~gI~V~n~P~~~~  103 (332)
T PRK08605         59 EAIYKLLNELGIKQIAQRSAGFDTYDLELANK--YNIIISNVPSYSP  103 (332)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCCHHHHHHHHH--CCCEEEECCCCCH
T ss_conf             99999666369779997772174546999997--9998995998684