HHsearch alignment for GI: 254780279 and conserved domain: PRK08618

>PRK08618 ornithine cyclodeaminase; Validated.
Probab=95.08  E-value=0.047  Score=34.24  Aligned_cols=91  Identities=11%  Similarity=0.139  Sum_probs=61.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCC-CCCCCCCCCCHHHHHCCCCEEEEEEC-CCHH
Q ss_conf             799989987799999999838997899999648980204553666087-54675455685785213550476310-1024
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGI-SPMGIKFSDNLAMAIQSVDGIIDFSS-PALT   84 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~-~~~~v~i~~dl~~~~~~~DViIDFT~-P~~~   84 (280)
T Consensus       129 ~l~iiGaG~QA~~~~~a~~~v~~i~~v~v~~r~~~~~--~~f~~~~~~~~g~~v~~~~~~~~av~~aDiV~taT~s~~Pv  206 (325)
T PRK08618        129 TLCLIGTGGQAKGQLEAVLAVRDIEKVRVYSRTFEKA--YAFAQEIQSKFNTEIYVVESADEAIEEADIIVTVTNAKTPV  206 (325)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHH--HHHHHHHHHHCCCCEEEECCHHHHHHHCCEEEEECCCCCCC
T ss_conf             6999756079999999998608966899994799999--99999998750996699589999984398899925999864


Q ss_pred             HHHHHHHHHCCCEEE-EEE
Q ss_conf             788876432372157-650
Q gi|254780279|r   85 LQSLNISAQHNIVHI-IGT  102 (280)
Q Consensus        85 ~~~~~~a~~~g~~vV-iGT  102 (280)
T Consensus       207 ---~~~~l~~g~hi~aiGs  222 (325)
T PRK08618        207 ---FSEKLKKGVHINAVGS  222 (325)
T ss_pred             ---CCCCCCCCEEECCCCC
T ss_conf             ---4543588717513246