HHsearch alignment for GI: 254780279 and conserved domain: PRK09117

>PRK09117 consensus.
Probab=96.92  E-value=0.0063  Score=40.18  Aligned_cols=98  Identities=15%  Similarity=0.292  Sum_probs=50.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHC------CCHHHHCC---C-------CCCCCCCCCCHHHHHC
Q ss_conf             799989987799999999838997899999648980204------55366608---7-------5467545568578521
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIG------QDVGNFVG---I-------SPMGIKFSDNLAMAIQ   70 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g------~d~~~~~~---~-------~~~~v~i~~dl~~~~~   70 (280)
T Consensus         4 ~VaViGaG~mG~~iA~~~a-~~G~~V~-l~D~~~~~l~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~i~~~~d~~-a~~   80 (282)
T PRK09117          4 TVGIIGAGTMGNGIAQACA-VAGLDVV-MVDISDAAVQRGLATVAGSLDRLIKKEKLTEADKAAALARIKGSTDYD-ALK   80 (282)
T ss_pred             EEEEECCCHHHHHHHHHHH-HCCCCEE-EEECCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHH-HHC
T ss_conf             7999897799999999999-6799689-998988999999999999999999706887788999984065679989-975


Q ss_pred             CCCEEEEEECCC-----HHHHHHHHHHHCCCEEEEEECCCCH
Q ss_conf             355047631010-----2478887643237215765022231
Q gi|254780279|r   71 SVDGIIDFSSPA-----LTLQSLNISAQHNIVHIIGTTGFSV  107 (280)
Q Consensus        71 ~~DViIDFT~P~-----~~~~~~~~a~~~g~~vViGTTG~~~  107 (280)
T Consensus        81 ~aDlViEav~E~l~iK~~lf~~l~~~~~~~~IlaSNTS~l~i  122 (282)
T PRK09117         81 DADLVIEAATENLDLKLKILKQLDALVGPDAIIATNTSSISI  122 (282)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             599999878588888899999998657998189865876761