HHsearch alignment for GI: 254780279 and conserved domain: PRK10083

>PRK10083 putative dehydrogenase; Provisional.
Probab=95.98  E-value=0.039  Score=34.73  Aligned_cols=130  Identities=15%  Similarity=0.167  Sum_probs=66.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHC----CCCEEEEEE-CC
Q ss_conf             7999899877999999998389978999996489802045536660875467545568578521----355047631-01
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQ----SVDGIIDFS-SP   81 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~----~~DViIDFT-~P   81 (280)
T Consensus       163 ~VlV~G~G~iGl~~~~~~~~~~ga~~Vi~~d~~~~rl---~~A~~~GAd~vi~~~~~~~~~~~~~~G~~~dvvid~~g~~  239 (339)
T PRK10083        163 VALIYGAGPVGLTIVQVLKGVYGVKNVIVADRIDERL---ALAKESGADWVINNAQESLAEALAEKGVKPTLIFDAACHP  239 (339)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCHHHH---HHHHHCCCCEEECCCCCCHHHHHHHCCCCCCEEEECCCCH
T ss_conf             8999587659999999999856997899937989999---9999719989984887669999985399961999666688


Q ss_pred             CHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCCCCCEECCCHHHHHHHHHHHHHHHH
Q ss_conf             02478887643237215765022231358999874035552100001156899999999999
Q gi|254780279|r   82 ALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAA  143 (280)
Q Consensus        82 ~~~~~~~~~a~~~g~~vViGTTG~~~e~~~~l~~~s~~~~il~apN~SiGv~ll~~l~~~~a  143 (280)
T Consensus       240 ~~~~~a~~~~~~gG~iv~~G~~~~-~~~i~~~~~~~k~l~i~-gs~~--~~~~~~~~~~li~  297 (339)
T PRK10083        240 SILEEAVTLASPAARIVLMGFSSE-PSEIVQQGITGKELTIY-SSRL--NANKFPVVIDWLA  297 (339)
T ss_pred             HHHHHHHHHHHCCEEEEEEECCCC-CCCCCHHHHHHCEEEEE-ECCC--CHHHHHHHHHHHH
T ss_conf             999999998518809999925899-87536888742678999-9226--8889999999998