HHsearch alignment for GI: 254780279 and conserved domain: PRK10309

>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional.
Probab=90.76  E-value=0.61  Score=26.59  Aligned_cols=93  Identities=13%  Similarity=0.169  Sum_probs=38.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHH---HHC--CC-CEEEEEE-
Q ss_conf             7999899877999999998389978999996489802045536660875467545568578---521--35-5047631-
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAM---AIQ--SV-DGIIDFS-   79 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~---~~~--~~-DViIDFT-   79 (280)
T Consensus       163 ~vlV~GaG~vGl~aiq~a-k~~Ga~~V~~~d~~~~kl---~~a~~lGAd~~i~~~~~~~~~~~~~~~~~~~d~vvid~~G  238 (347)
T PRK10309        163 NVIIIGAGTIGLLAIQCA-VALGAKSVTAIDINSEKL---ALAKSLGAMQTFNSREMSAPQIQSVLRELRFDQLILETAG  238 (347)
T ss_pred             EEEEECCCCHHHHHHHHH-HHCCCCEEEEEECCHHHH---HHHHHCCCCEEECCCCCCHHHHHHHHCCCCCCEEEEECCC
T ss_conf             699989983899999999-985997699992899999---9999729989986887799999998629988869997999


Q ss_pred             CCCHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             010247888764323721576502
Q gi|254780279|r   80 SPALTLQSLNISAQHNIVHIIGTT  103 (280)
Q Consensus        80 ~P~~~~~~~~~a~~~g~~vViGTT  103 (280)
T Consensus       239 ~~~~~~~a~~~~~~~G~iv~~G~~  262 (347)
T PRK10309        239 VPQTVELAIEIAGPRAQLALVGTL  262 (347)
T ss_pred             CHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             989999999961897499998057