HHsearch alignment for GI: 254780279 and conserved domain: PRK12480

>PRK12480 D-lactate dehydrogenase; Provisional.
Probab=93.63  E-value=0.24  Score=29.33  Aligned_cols=102  Identities=14%  Similarity=0.160  Sum_probs=73.8

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEECCCHHH
Q ss_conf             37999899877999999998389978999996489802045536660875467545568578521355047631010247
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTL   85 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~P~~~~   85 (280)
T Consensus         2 ~Ki~~~~~~~~e~~~~~~~~~~~~~e~~~~~~----------------------~~~~~~~~~~~~~d~v~~~~~~~i~~   59 (330)
T PRK12480          2 TKIMFFGTRDYEKEMALNWGKKNNVEVTTSKE----------------------LLSSATVDQLKDYDGVTTMQFGKLEN   59 (330)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCEEEEEECC----------------------CCCHHHHHHHCCCCEEEEEECCCCCH
T ss_conf             66999837686699999988774906999569----------------------89989999847999899960797899


Q ss_pred             HHHHHHHHCCCEEEE-EECCCCHHHHHHHHHHHCCCCCEECCCHHHH
Q ss_conf             888764323721576-5022231358999874035552100001156
Q gi|254780279|r   86 QSLNISAQHNIVHII-GTTGFSVKENEVISSFARNAPIVKSSNMSLG  131 (280)
Q Consensus        86 ~~~~~a~~~g~~vVi-GTTG~~~e~~~~l~~~s~~~~il~apN~SiG  131 (280)
T Consensus        60 evl~~l~~~~LK~I~~~gvG~D~IDl~aa~~--~GI~V~n~P~~~~~  104 (330)
T PRK12480         60 DVYPKLESYGIKQIAQRTAGFDMYDLDLAKK--HNIVISNVPSYSPE  104 (330)
T ss_pred             HHHHHHHHCCCEEEEECCEECCHHCHHHHHH--CCCEEEECCCCCHH
T ss_conf             9999655679759998772175216999997--89999959986828