HHsearch alignment for GI: 254780279 and conserved domain: PRK12767

>PRK12767 carbamoyl phosphate synthase-like protein; Provisional.
Probab=91.87  E-value=1.1  Score=24.78  Aligned_cols=77  Identities=19%  Similarity=0.184  Sum_probs=41.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEECCCH
Q ss_conf             73799989987799999999838-99789999964898020455366608754675455685785213550476310102
Q gi|254780279|r    5 PMRISVLGGGRMGQALIKEIHNN-PSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPAL   83 (280)
Q Consensus         5 ~IkV~I~GaGkMG~~ii~~i~~~-~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~~~DViIDFT~P~~   83 (280)
T Consensus         1 m~nILvt~~G~-~~~ii~~lk~~~~~~~Vi~-~D~~~~a-~-------------~~~~a-------D~~y~~P~~~d~~y   57 (325)
T PRK12767          1 MMNILVTSAGR-RVQLVKALKKSLLGGKVIG-ADISPLA-P-------------ALYFA-------DKFYVVPKVTDPNY   57 (325)
T ss_pred             CCEEEEECCCC-HHHHHHHHHHCCCCCEEEE-ECCCCCC-C-------------CHHHC-------CEEEECCCCCCHHH
T ss_conf             94899986786-8999999997699859999-6899899-5-------------34454-------88998788898789


Q ss_pred             HHHHHHHHHHCCCEEEEEECC
Q ss_conf             478887643237215765022
Q gi|254780279|r   84 TLQSLNISAQHNIVHIIGTTG  104 (280)
Q Consensus        84 ~~~~~~~a~~~g~~vViGTTG  104 (280)
T Consensus        58 ~~~ll~i~~~~~id~iiP~~d   78 (325)
T PRK12767         58 IDALLDICKKENIDALIPLID   78 (325)
T ss_pred             HHHHHHHHHHHCCCEEEECCC
T ss_conf             999999999879999997785