HHsearch alignment for GI: 254780279 and conserved domain: PTZ00023

>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional.
Probab=97.98  E-value=3.4e-05  Score=55.74  Aligned_cols=189  Identities=15%  Similarity=0.188  Sum_probs=99.8

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEEC-CCCHHH----------CCCHHHH--------CCCCCCCCCCCCCH
Q ss_conf             7379998998779999999983899789999964-898020----------4553666--------08754675455685
Q gi|254780279|r    5 PMRISVLGGGRMGQALIKEIHNNPSITLHSIIVR-SGSPLI----------GQDVGNF--------VGISPMGIKFSDNL   65 (280)
Q Consensus         5 ~IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~-~~~~~~----------g~d~~~~--------~~~~~~~v~i~~dl   65 (280)
T Consensus         2 ~ikigINGFGRIGR~v~R~~~~~~~i~vvaINd~~~~~~~~ayLlkyDS~hG~~~~~v~~~~~~l~i~~~~I~~~~~~dp   81 (337)
T PTZ00023          2 VVKIGINGFGRIGRLVHRASLARENVEVVAINDPFMTPDYIKYLLKYDSVHGSLPCEVSVTSDHLMIGSKKVHLFFEKDP   81 (337)
T ss_pred             CEEEEEECCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCEEEECCEEEECCEEEEEECCCCH
T ss_conf             67999956877899999998418994899978999999999998653678998999789838959999978875056996


Q ss_pred             HHHH---CCCCEEEEEECCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHH------HHHHCCCCCEECCCHHHHHHHHH
Q ss_conf             7852---13550476310102478887643237215765022231358999------87403555210000115689999
Q gi|254780279|r   66 AMAI---QSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVI------SSFARNAPIVKSSNMSLGINFLG  136 (280)
Q Consensus        66 ~~~~---~~~DViIDFT~P~~~~~~~~~a~~~g~~vViGTTG~~~e~~~~l------~~~s~~~~il~apN~SiGv~ll~  136 (280)
T Consensus        82 ~~ipW~~~gvDiViEcTG~f~~~~~a~~Hl~~GakkViiS-AP~~d~~~t~V~GVN~~~~~~~~~II--SnASCTTNclA  158 (337)
T PTZ00023         82 SQIPWGKNDVDVVAECTGVFTSTEKAKLHLKGGAKLVIIS-APPSDSTPIYVFGVNHTQYDKSQRIV--SNASCTTNCLA  158 (337)
T ss_pred             HHCCCCCCCCCEEEECCCCCCCHHHHHHHHHCCCCEEEEC-CCCCCCCCEEEEECCHHHCCCCCCEE--ECCCCCCCCHH
T ss_conf             6699220398789962654468899999987699779976-89988886799835634348767289--65631003003


Q ss_pred             HHHHHHHHHHCCCCCC---------HHHHHHHHHHCCCC-------------CCCHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             9999999861156660---------08999986416789-------------9867899999999853288764221112
Q gi|254780279|r  137 FLVETAAEYLLPAKDW---------DFEILEMHHRRKLD-------------SPSGTALLLGEAIANGRKVNLTDHMVLN  194 (280)
Q Consensus       137 ~l~~~~a~~l~~~~~~---------dieI~E~HH~~K~D-------------aPSGTA~~la~~i~~~~~~~~~~~~~~~  194 (280)
T Consensus       159 Pl~kvL~~~fgI~~g~mTTIHsyT~~Q~l~D~~h~~~kD~Rr~Raa~~nIIPtsTgAakAi~~VlPeL------------  226 (337)
T PTZ00023        159 PLAKVINDNFGIVEGLMTTVHAVTANQLTVDGASRGGKDWRAGRCAGVNIIPASTGAAKAVGKVIPEL------------  226 (337)
T ss_pred             HHHHHHHHHCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCHHHHHHHHHHHH------------
T ss_conf             07987865348678789986346688730457786777545664254178866563889998540530------------


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCC
Q ss_conf             35767654334565013752882
Q gi|254780279|r  195 RHIQQCARTEGSIGIASLRAGSI  217 (280)
Q Consensus       195 ~~~~~~~~~~~~I~i~s~R~g~~  217 (280)
T Consensus       227 ---------~GKl~g~A~RVPt~  240 (337)
T PTZ00023        227 ---------NGKLTGMAFRVPVS  240 (337)
T ss_pred             ---------CCCCCEEEEECCCC
T ss_conf             ---------79730368943787