HHsearch alignment for GI: 254780279 and conserved domain: TIGR00036

>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770 Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine. It catalyses the the reduced pyridine nucleotide-dependent reduction of the alpha,beta-unsaturated cyclic imine, dihydrodipicolinate, to generate tetrahydrodipicolinate as shown below : 2,3-dihydrodipicolinate + NAD(P)H = 2,3,4,5-tetrahydrodipicolinate + NAD(P)(+) As this enzyme is not found in mammals it is a potential target for the development of novel antibacterial and herbicidal compounds. The structures of the Escherichia coli (P04036 from SWISSPROT) and Mycobacterium tuberculosis (P72024 from SWISSPROT) enzymes have been determined , . The enzyme is a homotetramer where each monomer is composed of two domains, an N-terminal NAD(P)H-binding domain which forms a Rossman fold, and a C-terminal substrate-binding domain that forms an open, mixed alpha-beta sandwich.Tetramerisation occurs exclusively through interactions between C-terminal domain residues. Both enzymes show relatively little preference for either NADH or NADPH as cofactor. Conformational changes upon substrate binding bring the cofactor and substrate into close proximity and allow catalysis to occur. ; GO: 0008839 dihydrodipicolinate reductase activity, 0009089 lysine biosynthetic process via diaminopimelate, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=625.56  Aligned_cols=265  Identities=37%  Similarity=0.664  Sum_probs=258.2

Q ss_pred             CEEEEEECC-CHHHHHHHHHHHHC-CCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHH------HCCCCEEE
Q ss_conf             737999899-87799999999838-99789999964898020455366608754675455685785------21355047
Q gi|254780279|r    5 PMRISVLGG-GRMGQALIKEIHNN-PSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMA------IQSVDGII   76 (280)
Q Consensus         5 ~IkV~I~Ga-GkMG~~ii~~i~~~-~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~------~~~~DViI   76 (280)
T Consensus         1 ~ikvav~GA~GRMG~~~ik~~~~~ye~l~Lv~A~~~~~~~~~G~D~GEl~g~g~~gv~v~~~~~~~~~l~~~~~~~DVli   80 (281)
T TIGR00036         1 LIKVAVAGAAGRMGRELIKAVLQAYEGLKLVAAFERHGSSLQGTDIGELAGIGKVGVPVTDDLEAVLVLAFTETKPDVLI   80 (281)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             98358847887346999999997489816788886168885665420242255478410005788999874023686478


Q ss_pred             EEECCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCC--CCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCC-H
Q ss_conf             6310102478887643237215765022231358999874035--552100001156899999999999861156660-0
Q gi|254780279|r   77 DFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN--APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-D  153 (280)
Q Consensus        77 DFT~P~~~~~~~~~a~~~g~~vViGTTG~~~e~~~~l~~~s~~--~~il~apN~SiGv~ll~~l~~~~a~~l~~~~~~-d  153 (280)
T Consensus        81 DFT~p~g~~~~~~~a~~~Gv~~V~GTTGf~e~~~~~~~~~a~~~~~~~v~A~NFa~GV~~~~K~~~~aA~~l---~D~~D  157 (281)
T TIGR00036        81 DFTTPEGVVENVKIALENGVRLVVGTTGFSEEDLQELRDLAEKKGVAAVIAPNFAIGVNLMFKLLEKAAKYL---GDYTD  157 (281)
T ss_pred             ECCCCHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHH---CCCCC
T ss_conf             738605678999999966885577166899899999999998649978984650689999999999998762---45655


Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCCCCCCC---CEEEECCCCCEEEEEEEECCC
Q ss_conf             8999986416789986789999999985328-876422111235767654334565---013752882057999981899
Q gi|254780279|r  154 FEILEMHHRRKLDSPSGTALLLGEAIANGRK-VNLTDHMVLNRHIQQCARTEGSIG---IASLRAGSIVGEHSVVIAGEG  229 (280)
Q Consensus       154 ieI~E~HH~~K~DaPSGTA~~la~~i~~~~~-~~~~~~~~~~~~~~~~~~~~~~I~---i~s~R~g~~~g~H~V~f~~~~  229 (280)
T Consensus       158 iEIIE~HHr~K~DAPSGTAL~~~E~i~~~~~~~~~~~~~v~~REG~~G~R~~~~iGqI~~~~~RggDvvG~H~V~F~~~G  237 (281)
T TIGR00036       158 IEIIELHHRHKKDAPSGTALKLAEIIAEARGEKDIKEVAVTEREGLTGERGREEIGQIRIHAVRGGDVVGEHTVLFAGDG  237 (281)
T ss_pred             EEEEECHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEECCCC
T ss_conf             45441200258999707899999999987055430003655456777888888897137998725771354678875898


Q ss_pred             CEEEEEEEECCHHHHHHHHHHHHHHHHCCCC-CCCCHHHHHCCC
Q ss_conf             5899999972737679999999999834899-836888982688
Q gi|254780279|r  230 ESITLSHSAYDRRIFARGSLTAALWAKSQIP-GLYSMRDVLGIG  272 (280)
Q Consensus       230 E~i~i~H~a~~R~~Fa~Gal~aa~~l~~~~~-G~y~m~dvL~l~  272 (280)
T Consensus       238 E~~ei~H~A~sR~~F~~Gv~~a~~~~~~~~~g~~Y~~~d~L~lN  281 (281)
T TIGR00036       238 ERIEITHRASSRAAFANGVVRAIRWIADKDKGGVYDMEDVLGLN  281 (281)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCC
T ss_conf             54899861233678888999999999874178720557650379