HHsearch alignment for GI: 254780279 and conserved domain: TIGR00978

>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: IPR005676 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see . Aspartate-semialdehyde dehydrogenase, the second enzyme in the aspartate pathway, converts aspartyl phosphate to aspartate-semialdehyde, the branch point intermediate between the lysine and threonine/methionine pathways. Based on sequence alignments, the aspartate-semialdehyde dehydrogenase family appears to have two distinct subgroups, one found in most bacteria (Gram-positve and Gram-negative), while the other is found primarily in organisms lacking peptidoglycan (archaea,fungi and some bacteria). Most studies have been performed on enzymes isolated from Gram-negative bacteria , , , . The N-terminal domain forms the active site and NADP-binding pocket, while C-terminal domain is primarily involved in hydrophobic intersubunit contacts. The catalytic mechanism involves the formation of a covalent thioester acyl-enzyme intermediate mediated through nucleophilic attack by an active site cysteine residue on the substrate aspartyl phosphate. Release of inorganic phosphate is followed by hydride transfer from NADPH to yield the product. The recently described archaeal structure suggests that the two subgroups of aspartate semi-aldehyde dehydrogenase share similar structures and have an identical catalytic mechanism, despite their relatively low sequence identity . Unlike the bacterial enzymes, the archaeal enzyme utilised both NAD and NADP as cofactor. This entry represents the subgroup of aspartate dehydrogenases found primarily in organisms lacking peptidoglycan. In addition to its role in aspartate metabolism, the enzyme from Sulfolobus solfataricus has been shown recently to exhibit RNase activity, suggesting that these enzymes may perform additional cellular functions .; GO: 0004073 aspartate-semialdehyde dehydrogenase activity, 0009086 methionine biosynthetic process, 0009088 threonine biosynthetic process.
Probab=97.93  E-value=7.2e-05  Score=53.47  Aligned_cols=213  Identities=17%  Similarity=0.182  Sum_probs=121.5

Q ss_pred             EEEEEECC-CHHHHHHHHHHHHCC-CCEEEEEEECCCCHHHCCCHHHHCCC--C-CCCC-------CCCCCHHH--HHCC
Q ss_conf             37999899-877999999998389-97899999648980204553666087--5-4675-------45568578--5213
Q gi|254780279|r    6 MRISVLGG-GRMGQALIKEIHNNP-SITLHSIIVRSGSPLIGQDVGNFVGI--S-PMGI-------KFSDNLAM--AIQS   71 (280)
Q Consensus         6 IkV~I~Ga-GkMG~~ii~~i~~~~-~~eLv~~i~~~~~~~~g~d~~~~~~~--~-~~~v-------~i~~dl~~--~~~~   71 (280)
T Consensus         1 ~~VavLGaTG~VGq~f~~lL~~HPr~Fe~~~v~AS~~s--aGk~Yge~~~W~~~~~g~~Pe~~~dl~i~~~~p~ri~~d~   78 (358)
T TIGR00978         1 VRVAVLGATGLVGQKFVKLLEKHPRYFELAKVVASERS--AGKRYGEVVKWREILSGDIPEEVRDLEIVETEPVRIAEDH   78 (358)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEEECCCC--CCCCHHHHHHHCCCCCCCCCHHHCCCEEECCCCCEEEECC
T ss_conf             96899706554689999997526981228898836865--5767445430121236858432347654134743356617


Q ss_pred             CCEEEEEE-CCCHHH-HHHHHHHHCCCEEEEEECC-------------CCHHHHHHHHHHHCC---CC-CEECCCHHHHH
Q ss_conf             55047631-010247-8887643237215765022-------------231358999874035---55-21000011568
Q gi|254780279|r   72 VDGIIDFS-SPALTL-QSLNISAQHNIVHIIGTTG-------------FSVKENEVISSFARN---AP-IVKSSNMSLGI  132 (280)
Q Consensus        72 ~DViIDFT-~P~~~~-~~~~~a~~~g~~vViGTTG-------------~~~e~~~~l~~~s~~---~~-il~apN~SiGv  132 (280)
T Consensus        79 ~dVD~vfSALp~~~A~~~E~~la~~G~~VfSNAs~~RmdpdVPli~PEVN~~hL~l~~~Q~~RrgW~G~ivtNPNC~t~~  158 (358)
T TIGR00978        79 KDVDIVFSALPSEVAEEVEPKLAEEGIIVFSNASAHRMDPDVPLIVPEVNSDHLELLKVQKERRGWKGFIVTNPNCTTAG  158 (358)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCEEECCCCHHHHHHHHHCCCCCCCCCEEEECCHHHHHH
T ss_conf             98269981499799999999998569889876847788888677833356147999985400168861799576167887


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCCCHH------HHHH-HHHHHHHCCCCCCCCCCCCCCCCCCCC---
Q ss_conf             999999999998611566600899998641678998678------9999-999985328876422111235767654---
Q gi|254780279|r  133 NFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGT------ALLL-GEAIANGRKVNLTDHMVLNRHIQQCAR---  202 (280)
Q Consensus       133 ~ll~~l~~~~a~~l~~~~~~dieI~E~HH~~K~DaPSGT------A~~l-a~~i~~~~~~~~~~~~~~~~~~~~~~~---  202 (280)
T Consensus       159 l--Tl~Lk---Pl~d~~~-----~~~V-~v~TmQAvSGAGY~GVp~~~I~dN~iP~I~GEE-~KIe~E~~KilsGkl~~g  226 (358)
T TIGR00978       159 L--TLALK---PLIDAFG-----IKKV-IVTTMQAVSGAGYPGVPSMDILDNVIPHIGGEE-EKIERETLKILSGKLENG  226 (358)
T ss_pred             H--HHHHH---HHHHCCC-----CCEE-EEEEECCHHCCCCCCCCHHHHHCCCCCCCCCHH-HHHHHHHHHHHCCCCCCC
T ss_conf             7--61013---4643058-----4569-998720001488888754555336165506335-898762133334400388


Q ss_pred             ----CCCCCCCEEEECCCCCEEEEEEEECCCCEE
Q ss_conf             ----334565013752882057999981899589
Q gi|254780279|r  203 ----TEGSIGIASLRAGSIVGEHSVVIAGEGESI  232 (280)
Q Consensus       203 ----~~~~I~i~s~R~g~~~g~H~V~f~~~~E~i  232 (280)
T Consensus       227 ~~~PA~~~~~at~~RVPV~~GHt~~v~v~~~~~~  260 (358)
T TIGR00978       227 KIEPAEFEVSATTTRVPVLDGHTESVHVEFDKKF  260 (358)
T ss_pred             EEEEECCEEEEEEEECCCCCCCEEEEEEEECCCC
T ss_conf             4642044068998744411164699999866877