>TIGR01202 bchC Chlorophyll synthesis pathway, bchC; InterPro: IPR005903 Some prokaryotes, such as the purple and green sulphur bacteria, gain energy from a mode of photosynthesis that does not generate oxygen, and is inhibited by its presence , . These organisms do not include chlorophylls in their photosynthetic pigments, but instead use closely related molecules known as bacteriochlorophylls. Like chlorophylls, bacteriochlorophylls are tetrapyroles with a five-membered ring structure, differing in the side chains and hydration state of the ring structure. These alterations in structure determine what light wavelengths can be harvested by the organism . Bacteriochlorophyll a is a photosynthetic pigment found in many of the purple bacteria. It is synthesised from protoporphyrin IX in a series of reactions including magnesium-chelation, methyl transfer, ring formation, vinyl-group reduction protochlorophyllide reduction, and finally phytol addition . This entry represents 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide a dehydrogenase, the enzyme catalysing the penultimate step in light-independent bacteriochlorophyll a biosynthesis .; GO: 0016491 oxidoreductase activity, 0030494 bacteriochlorophyll biosynthetic process.

Probab=90.46 E-value=0.61 Score=26.57 Aligned_cols=94 Identities=16% Similarity=0.181 Sum_probs=64.7 Q ss_pred CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCCCHHHHCCCCCCCCCCCCCHHHHHC--CCCEEEEEE-CC Q ss_conf 737999899877999999998389978999996489802045536660875467545568578521--355047631-01 Q gi|254780279|r 5 PMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQ--SVDGIIDFS-SP 81 (280) Q Consensus 5 ~IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~d~~~~~~~~~~~v~i~~dl~~~~~--~~DViIDFT-~P 81 (280) T Consensus 155 ~~pdLivG~G~lGrLlArLt-~~aG~~~p~VwEt~~~R~~~a~gy~v~~------P~~ddvsval~rrdy~~i~D~sG~~ 227 (325) T TIGR01202 155 VLPDLIVGHGTLGRLLARLT-VAAGGSPPAVWETNPRRRDGATGYEVLD------PEKDDVSVALPRRDYRAIYDASGDP 227 (325) T ss_pred CCCCEEEECCHHHHHHHHHH-HHCCCCCCEEECCCHHHHHCCCCCEEEC------CCCCCEEEEECCCCEEEEEECCCCH T ss_conf 78712871678999999999-9718976355478668730145640337------7434635742587301787157867 Q ss_pred CHHHHHHHHHHHCCCEEEEEECCCCHH Q ss_conf 024788876432372157650222313 Q gi|254780279|r 82 ALTLQSLNISAQHNIVHIIGTTGFSVK 108 (280) Q Consensus 82 ~~~~~~~~~a~~~g~~vViGTTG~~~e 108 (280) T Consensus 228 ~~id~lv~rL~kgGe~vl---~GfYt~ 251 (325) T TIGR01202 228 SLIDTLVRRLAKGGEIVL---AGFYTE 251 (325) T ss_pred HHHHHHHHHHHCCCEEEE---ECCCCC T ss_conf 899999998732997998---033577

HHsearch alignment for GI: 254780279 and conserved domain: TIGR01202