>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors . The enzymes in this entry are found in archaea, bacteria and eukaryotes and fall into two distinct groups. The first group are cytoplamsic, NAD-dependent enzymes which participate in the citric acid cycle (1.1.1.37 from EC). The second group are found in plant chloroplasts, use NADP as cofactor, and participate in the C4 cycle (1.1.1.82 from EC). Structural studies indicate that these enzymes are homodimers with very sinmilar overall topology, though the chloroplast enzymes also have N- and C-terminal extensions, and all contain the classical Rossman fold for NAD(P)H binding , , , . Substrate specificity is determined by a mobile loop at the active site which uses charge balancing to discriminate between the correct substrates (malate and oxaloacetate) and other potential oxo/hydroxyacid substrates the enzyme may encounter within the cell .; GO: 0016615 malate dehydrogenase activity, 0006108 malate metabolic process.

Probab=91.44 E-value=0.76 Score=25.93 Aligned_cols=118 Identities=18% Similarity=0.346 Sum_probs=76.7 Q ss_pred CCEEEEEECC-CHHHHHHHHHHHH------CCCCEEEEEEECCCCH--HHCCCHHHHCCCC-C--CCCCCCCCHHHHHCC Q ss_conf 8737999899-8779999999983------8997899999648980--2045536660875-4--675455685785213 Q gi|254780279|r 4 SPMRISVLGG-GRMGQALIKEIHN------NPSITLHSIIVRSGSP--LIGQDVGNFVGIS-P--MGIKFSDNLAMAIQS 71 (280) Q Consensus 4 ~~IkV~I~Ga-GkMG~~ii~~i~~------~~~~eLv~~i~~~~~~--~~g~d~~~~~~~~-~--~~v~i~~dl~~~~~~ 71 (280) T Consensus 2 ~p~rV~VTGAAGQI~Y~Ll~~iA~G~~fG~Dqpv~L~-LLdIP~A~~~LeGV-~MEL~DCAFPlL~~v~~T~~p~eAF~d 79 (329) T TIGR01759 2 KPVRVAVTGAAGQIGYSLLFRIASGELFGKDQPVVLH-LLDIPQAMKALEGV-VMELEDCAFPLLAGVVATTDPEEAFKD 79 (329) T ss_pred CCEEEEEECCHHHHHHHHHHHHHCCCCCCCCCCEEEE-ECCCHHHHHHHHHH-HHHHHCCCCCCCCCCEECCCHHHHHCC T ss_conf 9537997374467899998898556104889846888-60772331133443-553530645223511221686875189 Q ss_pred CCEEEEEE--CCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCC-CCCEECCCHHHH Q ss_conf 55047631--0102478887643237215765022231358999874035-552100001156 Q gi|254780279|r 72 VDGIIDFS--SPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN-APIVKSSNMSLG 131 (280) Q Consensus 72 ~DViIDFT--~P~~~~~~~~~a~~~g~~vViGTTG~~~e~~~~l~~~s~~-~~il~apN~SiG 131 (280) T Consensus 80 vD~AlLvGa~PRK~GMER~DLL~~Ng~I-------F~-~QG~aLn~~Ak~~vKVLVVGNPaNT 134 (329) T TIGR01759 80 VDVALLVGAFPRKPGMERRDLLSKNGKI-------FK-EQGKALNKVAKKDVKVLVVGNPANT 134 (329) T ss_pred CCEEEEECCCCCCCCCCHHHHHHHCCHH-------HH-HHHHHHHHHCCCCCEEEEECCCCHH T ss_conf 8757761366895884479998722254-------68-7999999861898569985298627

HHsearch alignment for GI: 254780279 and conserved domain: TIGR01759