HHsearch alignment for GI: 254780279 and conserved domain: TIGR03026

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=97.02  E-value=0.0088  Score=39.21  Aligned_cols=122  Identities=13%  Similarity=0.205  Sum_probs=67.3

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHH----------HCCCHHHHCC--CCCCCCCCCCCHHHHHCCCC
Q ss_conf             37999899877999999998389978999996489802----------0455366608--75467545568578521355
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPL----------IGQDVGNFVG--ISPMGIKFSDNLAMAIQSVD   73 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~----------~g~d~~~~~~--~~~~~v~i~~dl~~~~~~~D   73 (280)
T Consensus         1 MkI~ViGlGyVGl~~a~~l-A~~G~~V~g-~D~d~~~i~~l~~g~~p~~E~gl~~ll~~~~~~~~l~~ttd~~~~i~~~d   78 (411)
T TIGR03026         1 MKIAVIGLGYVGLPLAALL-ADLGHEVTG-VDIDQEKVDKLNKGKSPIYEPGLDELLAKALAAGRLRATTDYEDAIRDAD   78 (411)
T ss_pred             CEEEEECCCHHHHHHHHHH-HHCCCCEEE-EECCHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCEEEECCHHHHHHHCC
T ss_conf             9799989787799999999-948994899-98999999999779899789898999999986399799878899872099


Q ss_pred             EEEEEE-CCC-----HHHHHHH-------HHHHCCCEEEEEEC---CCCHHHH-HHHHHHHC-----CCCCEECCCHH
Q ss_conf             047631-010-----2478887-------64323721576502---2231358-99987403-----55521000011
Q gi|254780279|r   74 GIIDFS-SPA-----LTLQSLN-------ISAQHNIVHIIGTT---GFSVKEN-EVISSFAR-----NAPIVKSSNMS  129 (280)
Q Consensus        74 ViIDFT-~P~-----~~~~~~~-------~a~~~g~~vViGTT---G~~~e~~-~~l~~~s~-----~~~il~apN~S  129 (280)
T Consensus        79 ii~I~V~TP~~~~g~~d~s~l~~a~~~i~~~l~~~~lvii~STV~pGTt~~i~~~ile~~~~~~~g~df~v~~~PEfl  156 (411)
T TIGR03026        79 VIIICVPTPLKEDGSPDLSYVESAAETIAKHLRKGATVVLESTVPPGTTEEVVKPILERASGLKLGEDFYLAYNPEFL  156 (411)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEEHHHHHHHHHHHCCCCCCCCEEEEECCCCC
T ss_conf             999976898666887213899999999997668999899957868681048999988774046668854799683546