HHsearch alignment for GI: 254780279 and conserved domain: cd00650

>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains
Probab=96.07  E-value=0.047  Score=34.21  Aligned_cols=123  Identities=21%  Similarity=0.276  Sum_probs=63.9

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCC---CEEEEEEECCCCHHHC--CCHHHHCCC-CCCCCCCCCCHHHHHCCCCEEEEE-E
Q ss_conf             999899-8779999999983899---7899999648980204--553666087-546754556857852135504763-1
Q gi|254780279|r    8 ISVLGG-GRMGQALIKEIHNNPS---ITLHSIIVRSGSPLIG--QDVGNFVGI-SPMGIKFSDNLAMAIQSVDGIIDF-S   79 (280)
Q Consensus         8 V~I~Ga-GkMG~~ii~~i~~~~~---~eLv~~i~~~~~~~~g--~d~~~~~~~-~~~~v~i~~dl~~~~~~~DViIDF-T   79 (280)
T Consensus         1 V~IIGA~G~VG~~~a~~l~~~~~~~~~el-~L~Di~~~~~~g~a~Dl~~~~~~~~~~~v~~~~~~~~~~~daDvVVitag   79 (263)
T cd00650           1 IAVIGAGGNVGPALAFGLADGSVLLAIEL-VLYDIDEEKLKGVAMDLQDAVEPLADIKVSITDDPYEAFKDADVVIITAG   79 (263)
T ss_pred             CEEECCCCHHHHHHHHHHHHCCCCCCCEE-EEEECCCCHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHCCCCEEEEECC
T ss_conf             98987797799999999982899999889-99958987208799999854523578739974873898379989999057


Q ss_pred             CCCHH-HHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCCCCCEECCCHHHHHHHHHHHHHHH
Q ss_conf             01024-7888764323721576502223135899987403555210000115689999999999
Q gi|254780279|r   80 SPALT-LQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETA  142 (280)
Q Consensus        80 ~P~~~-~~~~~~a~~~g~~vViGTTG~~~e~~~~l~~~s~~~~il~apN~SiGv~ll~~l~~~~  142 (280)
T Consensus        80 ~~~k~g~~R~-dll~~N~~I~-------~~i~~~i~~~~p~a~iivvtNP---vdv~t~~~~~~  132 (263)
T cd00650          80 VGRKPGMGRL-DLLKRNVPIV-------KEIGDNIEKYSPDAWIIVVSNP---VDIITYLVWRY  132 (263)
T ss_pred             CCCCCCCCHH-HHHHCHHHHH-------HHHHHHHHHCCCCCEEEECCCC---HHHHHHHHHHH
T ss_conf             7889998765-6640328899-------9998888732998369973894---89999999983