HHsearch alignment for GI: 254780279 and conserved domain: cd01483

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins. This family includes classical ubiquitin-activating enzymes E1, ubiquitin-like (ubl) activating enzymes and other mechanistic homologes, like MoeB, Thif1 and others. The common reaction mechanism catalyzed by MoeB, ThiF and the E1 enzymes begins with a nucleophilic attack of the C-terminal carboxylate of MoaD, ThiS and ubiquitin, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS.
Probab=97.11  E-value=0.0028  Score=42.55  Aligned_cols=99  Identities=19%  Similarity=0.204  Sum_probs=59.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCC-------------HHHCCCHHHH----C-CC------CCCCCCCC
Q ss_conf             79998998779999999983899789999964898-------------0204553666----0-87------54675455
Q gi|254780279|r    7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGS-------------PLIGQDVGNF----V-GI------SPMGIKFS   62 (280)
Q Consensus         7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~-------------~~~g~d~~~~----~-~~------~~~~v~i~   62 (280)
T Consensus         1 kVlivG~GglG~~va~~L~~~Gv-~~i~ivD~D~v~~~Nl~Rq~~~~~~dvG~~Ka~~a~~~l~~~np~v~i~~~~~~~~   79 (143)
T cd01483           1 RVLLVGLGGLGSEIALNLARSGV-GKITLIDFDTVELSNLNRQFLARQADIGKPKAEVAARRLNELNPGVNVTAVPEGIS   79 (143)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             99999979899999999999379-71999978987500146422589889492248999999985689838999945689


Q ss_pred             -CCHHHHHCCCCEEEEEE-CCCHHHHHHHHHHHCCCEEEEEEC-CCC
Q ss_conf             -68578521355047631-010247888764323721576502-223
Q gi|254780279|r   63 -DNLAMAIQSVDGIIDFS-SPALTLQSLNISAQHNIVHIIGTT-GFS  106 (280)
Q Consensus        63 -~dl~~~~~~~DViIDFT-~P~~~~~~~~~a~~~g~~vViGTT-G~~  106 (280)
T Consensus        80 ~~~~~~~~~~~dvvi~~~D~~~~r~~l~~~~~~~~ip~i~~~~~g~~  126 (143)
T cd01483          80 EDNLDDFLDGVDLVIDAIDNIAVRRALNRACKELGIPVIDAGGLGLG  126 (143)
T ss_pred             HHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCE
T ss_conf             64699997599999987799999999999999869988996366768