>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homol

Probab=96.78 E-value=0.011 Score=38.41 Aligned_cols=99 Identities=16% Similarity=0.239 Sum_probs=60.4 Q ss_pred EEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCC---------------HHHCCCHHHHC-----CCCC-CCCC----- Q ss_conf 79998998779999999983899789999964898---------------02045536660-----8754-6754----- Q gi|254780279|r 7 RISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGS---------------PLIGQDVGNFV-----GISP-MGIK----- 60 (280) Q Consensus 7 kV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~---------------~~~g~d~~~~~-----~~~~-~~v~----- 60 (280) T Consensus 21 ~VlVvG~GGLG~~v~~~La~-aGVg~i~ivD~D~Ve~sNL~RQ~l~~~~~~diG~~Ka~~a~~~l~~lNp~v~i~~~~~~ 99 (198) T cd01485 21 KVLIIGAGALGAEIAKNLVL-AGIDSITIVDHRLVSTEDLGSNFFLDAEVSNSGMNRAAASYEFLQELNPNVKLSIVEED 99 (198) T ss_pred CEEEECCCHHHHHHHHHHHH-CCCCEEEEEECCCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECC T ss_conf 89998778899999999997-49986999959963533577575026541116872999999999977999779998224 Q ss_pred ---CCCCHHHHHCCCCEEEEEEC-CCHHHHHHHHHHHCCCEEEEEE-CCCC Q ss_conf ---55685785213550476310-1024788876432372157650-2223 Q gi|254780279|r 61 ---FSDNLAMAIQSVDGIIDFSS-PALTLQSLNISAQHNIVHIIGT-TGFS 106 (280) Q Consensus 61 ---i~~dl~~~~~~~DViIDFT~-P~~~~~~~~~a~~~g~~vViGT-TG~~ 106 (280) T Consensus 100 ~~~~~~n~~~~~~~~DlVvd~~dn~~~r~~in~~c~~~~iPlI~ga~~G~~ 150 (198) T cd01485 100 SLSNDSNIEEYLQKFTLVIATEENYERTAKVNDVCRKHHIPFISCATYGLI 150 (198) T ss_pred CCCCHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEECCCCE T ss_conf 457786899998489999999999999999999999929988999745668

HHsearch alignment for GI: 254780279 and conserved domain: cd01485