HHsearch alignment for GI: 254780279 and conserved domain: cd05292

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=97.21  E-value=0.0035  Score=41.96  Aligned_cols=70  Identities=11%  Similarity=0.171  Sum_probs=44.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCHHHCC--CHHHHCCCCCCCCCCCCCHHHHHCCCCEEE
Q ss_conf             37999899877999999998389978999996489802045--536660875467545568578521355047
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQ--DVGNFVGISPMGIKFSDNLAMAIQSVDGII   76 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~~~g~--d~~~~~~~~~~~v~i~~dl~~~~~~~DViI   76 (280)
T Consensus         1 mKI~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a~~~~~~~~i~~~~~~-~l~daDvVV   72 (308)
T cd05292           1 MKVAIVGAGFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHGTPFVKPVRIYAGDYA-DCKGADVVV   72 (308)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHH-HHCCCCEEE
T ss_conf             979999948889999999986799887999918898451256876624103688168409999-977999999