HHsearch alignment for GI: 254780279 and conserved domain: pfam03721

>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=97.28  E-value=0.0042  Score=41.41  Aligned_cols=69  Identities=20%  Similarity=0.269  Sum_probs=37.1

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCH----------HHCCCHHHHCCCC-CCCCCCCCCHHHHHCCCCE
Q ss_conf             3799989987799999999838997899999648980----------2045536660875-4675455685785213550
Q gi|254780279|r    6 MRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSP----------LIGQDVGNFVGIS-PMGIKFSDNLAMAIQSVDG   74 (280)
Q Consensus         6 IkV~I~GaGkMG~~ii~~i~~~~~~eLv~~i~~~~~~----------~~g~d~~~~~~~~-~~~v~i~~dl~~~~~~~DV   74 (280)
T Consensus         1 MkI~ViGlGyVGl~~a~~la-~~G~~V~-g~D~d~~~v~~ln~g~~p~~E~~l~~~l~~~~~~~~~~~~~~~~~i~~~d~   78 (185)
T pfam03721         1 MRIAVIGLGYVGLPTAVCLA-EIGHDVV-GVDINQSKIDKLNNGKIPIYEPGLEELLKANVSGRLRFTTDVAEAIKEADV   78 (185)
T ss_pred             CEEEEECCCHHHHHHHHHHH-HCCCEEE-EEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCEEEECCHHHHHHHCCE
T ss_conf             97999897874899999999-4899399-997998999998626897467588999987340896998787998844989


Q ss_pred             EE
Q ss_conf             47
Q gi|254780279|r   75 II   76 (280)
Q Consensus        75 iI   76 (280)
T Consensus        79 i~   80 (185)
T pfam03721        79 IF   80 (185)
T ss_pred             EE
T ss_conf             99