BLAST/PSIBLAST alignment of GI: 254780279 and GI: 86355830 at iteration 1
>gi|86355830|ref|YP_467722.1| dihydrodipicolinate reductase [Rhizobium etli CFN 42] Length = 274
>gi|86279932|gb|ABC88995.1| dihydrodipicolinate reductase protein [Rhizobium etli CFN 42] Length = 274
 Score =  281 bits (718), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 144/272 (52%), Positives = 191/272 (70%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+   +TLH+ + R+GSP IG+D G   G+ P G+
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGVTLHAAVERAGSPFIGKDAGEIAGLGPTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF++PA T++   ++AQ  IVH++GTTG S ++N  I++ AR+
Sbjct: 61  IIGDDPLQAFLHAEGVVDFTAPAATVEFSGLAAQARIVHVVGTTGCSTEDNTKIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A +VKS NMSLG+N L  L E AA  L PA DWD EILEMHHR K+D+PSGTALL GEA 
Sbjct: 121 ARVVKSGNMSLGVNLLSVLAEQAARALDPA-DWDIEILEMHHRHKVDAPSGTALLFGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRNIDLASKSVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDEKPGLYSMLDVLGL 271