BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780279|ref|YP_003064692.1| dihydrodipicolinate reductase
[Candidatus Liberibacter asiaticus str. psy62]
         (280 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780279|ref|YP_003064692.1| dihydrodipicolinate reductase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254039956|gb|ACT56752.1| dihydrodipicolinate reductase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 280

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 280/280 (100%), Positives = 280/280 (100%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK
Sbjct: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
           FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA
Sbjct: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
           PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA
Sbjct: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD
Sbjct: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE 280
           RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE
Sbjct: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE 280


>gi|315122839|ref|YP_004063328.1| dihydrodipicolinate reductase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496241|gb|ADR52840.1| dihydrodipicolinate reductase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 276

 Score =  424 bits (1090), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/277 (74%), Positives = 241/277 (87%), Gaps = 1/277 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M +SPMRI +LGGGRMG++LI EIHNNPS  L S++VR GSPL+GQDVG+ VGIS +G+K
Sbjct: 1   MQKSPMRIVILGGGRMGRSLINEIHNNPSFILTSVVVRQGSPLVGQDVGDVVGISTIGVK 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
           FSD+L  A+QSVDGIIDFSSP LTLQSL+IS+Q N+VH+IGTTGFS+KENE+I+SFA+N 
Sbjct: 61  FSDDLVTAMQSVDGIIDFSSPVLTLQSLDISSQRNLVHVIGTTGFSIKENEMIASFAKNC 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IVKS NMSLGINFL FLV+TA+EY  P+KDWDFEILEMHHRRKLDSPSGTA LLGEAIA
Sbjct: 121 RIVKSGNMSLGINFLRFLVKTASEY-FPSKDWDFEILEMHHRRKLDSPSGTAFLLGEAIA 179

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GRKVN  DH+VLNR+ QQ  R EGSIGI+SLR GSIVGEHSVV+AGEGESITLSHSA+D
Sbjct: 180 EGRKVNFADHVVLNRNKQQRVREEGSIGISSLRGGSIVGEHSVVVAGEGESITLSHSAHD 239

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEK 277
           R +FARG+LTAALWA+ +  GLYSM DVL + L ++K
Sbjct: 240 RCVFARGALTAALWAEFKNFGLYSMYDVLDVELIRKK 276


>gi|150398560|ref|YP_001329027.1| dihydrodipicolinate reductase [Sinorhizobium medicae WSM419]
 gi|166224177|sp|A6UEW2|DAPB_SINMW RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|150030075|gb|ABR62192.1| Dihydrodipicolinate reductase [Sinorhizobium medicae WSM419]
          Length = 272

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 194/272 (71%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M ++ MR+ V+G  GRMGQ LI+ +H  P + LH+ I RSGSP +G+D G   G+  MG+
Sbjct: 1   MSETDMRLVVVGAAGRMGQTLIRIVHETPGVRLHAAIERSGSPFLGRDAGELAGVGQMGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD    A    +G++DF++P+ T++  +++AQ  IVH++GTTG S  +   I + AR+
Sbjct: 61  AVSDKPLEAFVEAEGVLDFTAPSATVEFADLAAQARIVHVVGTTGCSADDEARIRAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A ++KS NMSLG+N LG L E AA  L PA+ WD EILEMHHR K+D+PSGTALLLGEA 
Sbjct: 121 ARVIKSGNMSLGVNLLGVLTEKAARAL-PAQGWDIEILEMHHRHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR + L DH V  R     AR EG+IG A+LR GS++GEHSVVIAGEGE +TLSHSA 
Sbjct: 180 ARGRGIKLADHSVRVRDGHTGARVEGAIGFATLRGGSVIGEHSVVIAGEGEMVTLSHSAT 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG+++AA+W +SQ PG YSM DVLG+
Sbjct: 240 DRSIFARGAVSAAIWGRSQKPGFYSMLDVLGL 271


>gi|227823992|ref|YP_002827965.1| dihydrodipicolinate reductase [Sinorhizobium fredii NGR234]
 gi|254767055|sp|C3MBY7|DAPB_RHISN RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|227342994|gb|ACP27212.1| dihydrodipicolinate reductase [Sinorhizobium fredii NGR234]
          Length = 272

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 190/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M ++ M++ V+G  GRMGQ LI+ +H    + LH+ I RS SP IG+D G   G+ P+G+
Sbjct: 1   MSETDMKLVVVGAAGRMGQTLIRTVHEAAGVRLHAAIERSNSPFIGRDAGELAGLGPIGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D    A    +G++DF++PA T++   ++AQ  IVH+IGTTG S  +   I + AR+
Sbjct: 61  PITDKPLEAFVEAEGVLDFTAPAGTVEFAGLAAQARIVHVIGTTGCSADDEAKIRAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A +VKS NMSLG+N LG L ETAA  L  AKDWD EILEMHHR K+D+PSGTALLLGEA 
Sbjct: 121 ARVVKSGNMSLGVNLLGVLTETAARAL-SAKDWDIEILEMHHRHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L D  V  R      R +G+IG A+LR G +VGEHSV++AGEGE +TLSHSA 
Sbjct: 180 AKGRGIDLADQAVKVRDGHTGPRPQGTIGFATLRGGLVVGEHSVILAGEGELVTLSHSAT 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALW +SQ PG Y+M DVLG+
Sbjct: 240 DRSIFARGAVAAALWGRSQKPGFYTMLDVLGL 271


>gi|15963914|ref|NP_384267.1| dihydrodipicolinate reductase [Sinorhizobium meliloti 1021]
 gi|307306329|ref|ZP_07586073.1| dihydrodipicolinate reductase [Sinorhizobium meliloti BL225C]
 gi|307319216|ref|ZP_07598645.1| dihydrodipicolinate reductase [Sinorhizobium meliloti AK83]
 gi|17366262|sp|P58326|DAPB1_RHIME RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|15073089|emb|CAC41548.1| Probable dihydrodipicolinate reductase [Sinorhizobium meliloti
           1021]
 gi|306895052|gb|EFN25809.1| dihydrodipicolinate reductase [Sinorhizobium meliloti AK83]
 gi|306902171|gb|EFN32768.1| dihydrodipicolinate reductase [Sinorhizobium meliloti BL225C]
          Length = 272

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 192/272 (70%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M+++ M++ V+G  GRMGQ LI+ IH    + LH+ I R+GSP IG+D G   G  PMG+
Sbjct: 1   MNETDMKLVVVGAAGRMGQTLIRIIHETAGVRLHAAIERTGSPFIGRDAGELAGAGPMGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D    A    +G++DF++PA T++   ++AQ  IVH++GTTG S  +   I + AR+
Sbjct: 61  AVTDKPLEAFVEAEGVLDFTAPAATVEFAGLAAQARIVHVVGTTGCSADDEARIRAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A ++KS NMSLG+N LG L E AA  L PA  WD EILEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARVIKSGNMSLGVNLLGVLTEKAARAL-PAGGWDIEILEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L DH V  R     AR EGSIG A+LR GS++GEHSVVIAGEGE +TLSHSA 
Sbjct: 180 ARGRGIDLADHSVRVRDGHTGARPEGSIGFATLRGGSVIGEHSVVIAGEGEMVTLSHSAT 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALW +S+ PG YSM DVLG+
Sbjct: 240 DRSIFARGAVAAALWGRSRKPGFYSMLDVLGL 271


>gi|222084416|ref|YP_002542945.1| dihydrodipicolinate reductase protein [Agrobacterium radiobacter
           K84]
 gi|254767029|sp|B9J6R4|DAPB_AGRRK RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|221721864|gb|ACM25020.1| dihydrodipicolinate reductase protein [Agrobacterium radiobacter
           K84]
          Length = 274

 Score =  288 bits (736), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 188/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M    M++ V+G  GRMGQALI+ IH    +TLH+ + R GS  IG+D G   G+  +GI
Sbjct: 1   MSDDAMKLVVVGAAGRMGQALIRLIHATEGLTLHAAVARPGSAFIGKDAGEIAGLGQIGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D+   A    DG+IDF++PA ++   +++AQ  IVH+IGTTG S ++     + AR+
Sbjct: 61  PVTDDPLSAFLHADGVIDFTTPATSVTFADLAAQARIVHVIGTTGCSAEDETRFKAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NM LGIN L  LVE AA  L PA DWD E+LEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARIVKSGNMGLGINLLSVLVEQAARALPPA-DWDIEVLEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L DH V  R      R  GSIG A+LR G+++G+HSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRGIDLGDHSVRVRDGYTGPRPAGSIGFATLRGGAVIGDHSVIFAGEGERLTLSHSAG 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR +FARG+L AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSLFARGALQAALWARDKKPGLYSMLDVLGL 271


>gi|86355830|ref|YP_467722.1| dihydrodipicolinate reductase [Rhizobium etli CFN 42]
 gi|86279932|gb|ABC88995.1| dihydrodipicolinate reductase protein [Rhizobium etli CFN 42]
          Length = 274

 Score =  281 bits (718), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 144/272 (52%), Positives = 191/272 (70%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+   +TLH+ + R+GSP IG+D G   G+ P G+
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGVTLHAAVERAGSPFIGKDAGEIAGLGPTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF++PA T++   ++AQ  IVH++GTTG S ++N  I++ AR+
Sbjct: 61  IIGDDPLQAFLHAEGVVDFTAPAATVEFSGLAAQARIVHVVGTTGCSTEDNTKIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A +VKS NMSLG+N L  L E AA  L PA DWD EILEMHHR K+D+PSGTALL GEA 
Sbjct: 121 ARVVKSGNMSLGVNLLSVLAEQAARALDPA-DWDIEILEMHHRHKVDAPSGTALLFGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRNIDLASKSVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDEKPGLYSMLDVLGL 271


>gi|218515892|ref|ZP_03512732.1| dihydrodipicolinate reductase [Rhizobium etli 8C-3]
          Length = 274

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 144/272 (52%), Positives = 190/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+   +TLH+ + R+GSP +G+D G   G+ P G+
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSMEGVTLHAAVERTGSPFVGKDAGEIAGLGPTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF+SPA T++   ++AQ  IVHI+GTTG S  +N  I++ AR+
Sbjct: 61  IIGDDPLNAFLHAEGVLDFTSPAATVEFSGLAAQARIVHIVGTTGCSEDDNARIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  L E A+  L P  DWD EILEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARIVKSGNMSLGVNLLSVLTEQASRALDP-DDWDIEILEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRGIDLASKSVKVRDGHTGAREAGTIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDKKPGLYSMLDVLGL 271


>gi|209551698|ref|YP_002283615.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537454|gb|ACI57389.1| Dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 274

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 189/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+    TLH+ + RSGSP IG+D G   G+ P GI
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGATLHAAVERSGSPFIGKDAGEIAGLGPSGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF+SPA T +   ++AQ  IVH++GTTG S  ++  I++ AR+
Sbjct: 61  LIGDDPLNAFLHAEGVLDFTSPAATAEFSGLAAQARIVHVVGTTGCSADDDARIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A +VKS NMSLG+N L  L E AA  L P +DWD EILEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARVVKSGNMSLGVNLLSVLAEQAARALEP-EDWDIEILEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRGIDLASKSVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDKKPGLYSMLDVLGL 271


>gi|116249947|ref|YP_765785.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254595|emb|CAK05669.1| putative dihydrodipicolinate reductase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 274

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 189/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+   + LH+ + R+GSP +G+D G   G+ P G+
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGVRLHAAVERAGSPFVGKDAGEIAGLGPTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF+SPA T++   ++AQ  IVH++GTTG S  +N  I++ AR+
Sbjct: 61  IIGDDPLNAFLDAEGVLDFTSPAATVEFSGLAAQARIVHVVGTTGCSADDNTKIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  L E AA  L P  DWD EILEMHH+ K+D+PSGTALL+GEA 
Sbjct: 121 ARIVKSGNMSLGVNLLSVLAEQAARALDP-DDWDIEILEMHHKHKVDAPSGTALLIGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRGIDLASQSVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDKKPGLYSMLDVLGL 271


>gi|327192337|gb|EGE59301.1| dihydrodipicolinate reductase [Rhizobium etli CNPAF512]
          Length = 274

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 189/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+   +TLH+ + R+GSP IG+D G   G+ P G+
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSMEGVTLHAAVERTGSPFIGKDAGEIAGLGPTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF+SPA T++   + AQ  IVHI+GTTG S  +N  I++ AR+
Sbjct: 61  IIGDDPLNAFLHAEGVLDFTSPAATVEFSGLVAQARIVHIVGTTGCSEDDNARIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  L E A+  L P  DWD EILEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARIVKSGNMSLGVNLLSVLTEQASRALDP-DDWDIEILEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRGIDLASKSVKVRDGHTGAREVGAIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDKKPGLYSMLDVLGL 271


>gi|241207122|ref|YP_002978218.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240861012|gb|ACS58679.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 274

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 143/272 (52%), Positives = 188/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+   +TLH+ + R+GSP +G+D G   G+ P G+
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSIDGVTLHAAVERAGSPFVGKDAGEIAGLGPTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF+SPA T++   ++AQ  IVH+IGTTG    +N  I++ AR+
Sbjct: 61  IVGDDPLNAFLDAEGVLDFTSPAATVEFSGLAAQARIVHVIGTTGCLPDDNAKIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  L E AA  L P  DWD EILEMHH+ K+D+PSGTALL GEA 
Sbjct: 121 ARIVKSGNMSLGVNLLSVLAEQAARALDP-DDWDIEILEMHHKHKVDAPSGTALLFGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRSIDLAAKSVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDKKPGLYSMLDVLGL 271


>gi|190889846|ref|YP_001976388.1| dihydrodipicolinate reductase [Rhizobium etli CIAT 652]
 gi|190695125|gb|ACE89210.1| dihydrodipicolinate reductase protein [Rhizobium etli CIAT 652]
          Length = 274

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 144/272 (52%), Positives = 189/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + M++ V+G  GRMGQ LI+ IH+    TLH+ + R+GSP +G+D G   G+ P G+
Sbjct: 1   MSDAAMKLVVVGAAGRMGQTLIRLIHSIEGATLHAAVERTGSPFVGKDAGEIAGLGPTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+   A    +G++DF+SPA T++   ++AQ  IVHI+GTTG S  +N  I++ AR+
Sbjct: 61  IIGDDPLNAFLHAEGVLDFTSPAGTVEFSGLAAQARIVHIVGTTGCSEDDNARIAAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  L E A+  L P  DWD EILEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARIVKSGNMSLGVNLLSVLTEQASRALDP-DDWDIEILEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR ++L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE +TLSHSA 
Sbjct: 180 AKGRGIDLASKSVKVRDGHTGAREAGTIGFATLRGGSVIGEHSVLFAGEGEIVTLSHSAA 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 DRSIFARGAIKAALWARDKKPGLYSMLDVLGL 271


>gi|254719859|ref|ZP_05181670.1| dihydrodipicolinate reductase [Brucella sp. 83/13]
 gi|265984875|ref|ZP_06097610.1| dihydrodipicolinate reductase [Brucella sp. 83/13]
 gi|306837561|ref|ZP_07470433.1| dihydrodipicolinate reductase [Brucella sp. NF 2653]
 gi|264663467|gb|EEZ33728.1| dihydrodipicolinate reductase [Brucella sp. 83/13]
 gi|306407345|gb|EFM63552.1| dihydrodipicolinate reductase [Brucella sp. NF 2653]
          Length = 279

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 184/269 (68%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +
Sbjct: 10  SEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAIT 69

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A I
Sbjct: 70  DDPLPVFAKAQGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATI 129

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A G
Sbjct: 130 VKSGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARG 188

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR 
Sbjct: 189 RDIALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGAGERVVLSHHAEDRS 248

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 249 IFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|222147196|ref|YP_002548153.1| dihydrodipicolinate reductase [Agrobacterium vitis S4]
 gi|254767030|sp|B9JYQ3|DAPB_AGRVS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|221734186|gb|ACM35149.1| dihydrodipicolinate reductase [Agrobacterium vitis S4]
          Length = 270

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 184/267 (68%), Gaps = 2/267 (0%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ V+G  GRMGQAL++ I       LH+ + R GS  IG+D G+  G+ P+G+  +D+
Sbjct: 1   MKLVVVGVSGRMGQALVRIICETQGAVLHAAVGRPGSASIGRDAGDLAGVGPLGVPVTDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  + DG+IDF+ P  +++   ++AQ  IVHIIGTTG S  +     + AR+A IVK
Sbjct: 61  ALAAFVNADGVIDFTRPETSVEFSALAAQARIVHIIGTTGCSPADEARFEAAARHARIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV  AA+ L  A  WD E+LEMHH+ K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLSVLVAQAAKAL-EASGWDIEVLEMHHKHKVDAPSGTALLLGEAAAKGRG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           ++LT+  V  R      R  GSIG A+LR GS++GEHSV++AGEGE +TLSHSA DR IF
Sbjct: 180 IDLTEKAVKVRDGHTGPREPGSIGFATLRGGSVIGEHSVLLAGEGEIVTLSHSAGDRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA+ + PGLYSM DVLG+
Sbjct: 240 ARGAVKAALWAQDKKPGLYSMLDVLGL 266


>gi|148558058|ref|YP_001257959.1| dihydrodipicolinate reductase [Brucella ovis ATCC 25840]
 gi|161621099|ref|YP_001594985.1| dihydrodipicolinate reductase [Brucella canis ATCC 23365]
 gi|163845164|ref|YP_001622819.1| dihydrodipicolinate reductase [Brucella suis ATCC 23445]
 gi|254700244|ref|ZP_05162072.1| dihydrodipicolinate reductase [Brucella suis bv. 5 str. 513]
 gi|254703366|ref|ZP_05165194.1| dihydrodipicolinate reductase [Brucella suis bv. 3 str. 686]
 gi|254705492|ref|ZP_05167320.1| dihydrodipicolinate reductase [Brucella pinnipedialis M163/99/10]
 gi|254710725|ref|ZP_05172536.1| dihydrodipicolinate reductase [Brucella pinnipedialis B2/94]
 gi|254712805|ref|ZP_05174616.1| dihydrodipicolinate reductase [Brucella ceti M644/93/1]
 gi|254715875|ref|ZP_05177686.1| dihydrodipicolinate reductase [Brucella ceti M13/05/1]
 gi|256029107|ref|ZP_05442721.1| dihydrodipicolinate reductase [Brucella pinnipedialis M292/94/1]
 gi|256157299|ref|ZP_05455217.1| dihydrodipicolinate reductase [Brucella ceti M490/95/1]
 gi|256253724|ref|ZP_05459260.1| dihydrodipicolinate reductase [Brucella ceti B1/94]
 gi|260167801|ref|ZP_05754612.1| dihydrodipicolinate reductase [Brucella sp. F5/99]
 gi|260567705|ref|ZP_05838174.1| dihydrodipicolinate reductase [Brucella suis bv. 4 str. 40]
 gi|261217636|ref|ZP_05931917.1| dihydrodipicolinate reductase [Brucella ceti M13/05/1]
 gi|261220859|ref|ZP_05935140.1| dihydrodipicolinate reductase [Brucella ceti B1/94]
 gi|261312898|ref|ZP_05952095.1| dihydrodipicolinate reductase [Brucella pinnipedialis M163/99/10]
 gi|261318293|ref|ZP_05957490.1| dihydrodipicolinate reductase [Brucella pinnipedialis B2/94]
 gi|261320512|ref|ZP_05959709.1| dihydrodipicolinate reductase [Brucella ceti M644/93/1]
 gi|261750739|ref|ZP_05994448.1| dihydrodipicolinate reductase [Brucella suis bv. 5 str. 513]
 gi|261753994|ref|ZP_05997703.1| dihydrodipicolinate reductase [Brucella suis bv. 3 str. 686]
 gi|261757237|ref|ZP_06000946.1| dihydrodipicolinate reductase [Brucella sp. F5/99]
 gi|265986091|ref|ZP_06098648.1| dihydrodipicolinate reductase [Brucella pinnipedialis M292/94/1]
 gi|265995785|ref|ZP_06108342.1| dihydrodipicolinate reductase [Brucella ceti M490/95/1]
 gi|148369343|gb|ABQ62215.1| dihydrodipicolinate reductase [Brucella ovis ATCC 25840]
 gi|161337910|gb|ABX64214.1| dihydrodipicolinate reductase [Brucella canis ATCC 23365]
 gi|163675887|gb|ABY39997.1| dihydrodipicolinate reductase [Brucella suis ATCC 23445]
 gi|260154370|gb|EEW89451.1| dihydrodipicolinate reductase [Brucella suis bv. 4 str. 40]
 gi|260919443|gb|EEX86096.1| dihydrodipicolinate reductase [Brucella ceti B1/94]
 gi|260922725|gb|EEX89293.1| dihydrodipicolinate reductase [Brucella ceti M13/05/1]
 gi|261293202|gb|EEX96698.1| dihydrodipicolinate reductase [Brucella ceti M644/93/1]
 gi|261297516|gb|EEY01013.1| dihydrodipicolinate reductase [Brucella pinnipedialis B2/94]
 gi|261301924|gb|EEY05421.1| dihydrodipicolinate reductase [Brucella pinnipedialis M163/99/10]
 gi|261737221|gb|EEY25217.1| dihydrodipicolinate reductase [Brucella sp. F5/99]
 gi|261740492|gb|EEY28418.1| dihydrodipicolinate reductase [Brucella suis bv. 5 str. 513]
 gi|261743747|gb|EEY31673.1| dihydrodipicolinate reductase [Brucella suis bv. 3 str. 686]
 gi|262550082|gb|EEZ06243.1| dihydrodipicolinate reductase [Brucella ceti M490/95/1]
 gi|264658288|gb|EEZ28549.1| dihydrodipicolinate reductase [Brucella pinnipedialis M292/94/1]
          Length = 279

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 184/269 (68%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +
Sbjct: 10  SEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAIT 69

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A I
Sbjct: 70  DDPLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATI 129

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A G
Sbjct: 130 VKSGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARG 188

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR 
Sbjct: 189 RDIALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRS 248

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 249 IFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|189023128|ref|YP_001932869.1| dihydrodipicolinate reductase [Brucella abortus S19]
 gi|237817420|ref|ZP_04596412.1| dihydrodipicolinate reductase [Brucella abortus str. 2308 A]
 gi|254690636|ref|ZP_05153890.1| dihydrodipicolinate reductase [Brucella abortus bv. 6 str. 870]
 gi|254696060|ref|ZP_05157888.1| dihydrodipicolinate reductase [Brucella abortus bv. 3 str. Tulya]
 gi|254699168|ref|ZP_05160996.1| dihydrodipicolinate reductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254732612|ref|ZP_05191190.1| dihydrodipicolinate reductase [Brucella abortus bv. 4 str. 292]
 gi|256255817|ref|ZP_05461353.1| dihydrodipicolinate reductase [Brucella abortus bv. 9 str. C68]
 gi|260545112|ref|ZP_05820933.1| dihydrodipicolinate reductase [Brucella abortus NCTC 8038]
 gi|260756207|ref|ZP_05868555.1| dihydrodipicolinate reductase [Brucella abortus bv. 6 str. 870]
 gi|260760424|ref|ZP_05872772.1| dihydrodipicolinate reductase [Brucella abortus bv. 4 str. 292]
 gi|260763664|ref|ZP_05875996.1| dihydrodipicolinate reductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882031|ref|ZP_05893645.1| dihydrodipicolinate reductase [Brucella abortus bv. 9 str. C68]
 gi|261216491|ref|ZP_05930772.1| dihydrodipicolinate reductase [Brucella abortus bv. 3 str. Tulya]
 gi|297249188|ref|ZP_06932889.1| dihydrodipicolinate reductase [Brucella abortus bv. 5 str. B3196]
 gi|189021702|gb|ACD74423.1| dihydrodipicolinate reductase [Brucella abortus S19]
 gi|237788233|gb|EEP62449.1| dihydrodipicolinate reductase [Brucella abortus str. 2308 A]
 gi|260098383|gb|EEW82257.1| dihydrodipicolinate reductase [Brucella abortus NCTC 8038]
 gi|260670742|gb|EEX57682.1| dihydrodipicolinate reductase [Brucella abortus bv. 4 str. 292]
 gi|260674085|gb|EEX60906.1| dihydrodipicolinate reductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676315|gb|EEX63136.1| dihydrodipicolinate reductase [Brucella abortus bv. 6 str. 870]
 gi|260871559|gb|EEX78628.1| dihydrodipicolinate reductase [Brucella abortus bv. 9 str. C68]
 gi|260918098|gb|EEX84959.1| dihydrodipicolinate reductase [Brucella abortus bv. 3 str. Tulya]
 gi|297173057|gb|EFH32421.1| dihydrodipicolinate reductase [Brucella abortus bv. 5 str. B3196]
          Length = 279

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 184/269 (68%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +
Sbjct: 10  SEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAIT 69

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A I
Sbjct: 70  DDPLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATI 129

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A G
Sbjct: 130 VKSGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARG 188

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR 
Sbjct: 189 RDIALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRS 248

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 249 IFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|239832676|ref|ZP_04681005.1| dihydrodipicolinate reductase [Ochrobactrum intermedium LMG 3301]
 gi|239824943|gb|EEQ96511.1| dihydrodipicolinate reductase [Ochrobactrum intermedium LMG 3301]
          Length = 277

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 183/271 (67%), Gaps = 2/271 (0%)

Query: 2   HQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
             S M + V+G GGRMGQ LI+ I       L   I RS SPL+G+D G   GI P+G+ 
Sbjct: 6   QNSEMGLVVVGAGGRMGQTLIRTIQTIEGAKLVGAIERSSSPLLGRDAGEVTGIGPLGVS 65

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S ++ + I + AR+A
Sbjct: 66  ITDDPLPVFAGAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDEDKIRAAARHA 125

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IVKS NMSLG+N L  LV+ AA+ L PA D+D EILEMHH+ K+D+PSGTALLLGEA A
Sbjct: 126 TIVKSGNMSLGVNLLSVLVQKAAQALDPA-DFDIEILEMHHKHKVDAPSGTALLLGEAAA 184

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR + L ++ V  R      R  GSIG A+LR GS++GEHSV++AG GE I LSH A D
Sbjct: 185 KGRDIALAENSVRVRDGYTGPRETGSIGFATLRGGSVIGEHSVILAGPGERIVLSHHAED 244

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 245 RSIFARGAIKAALWAYGKKPGLYSMLDVLGL 275


>gi|306840209|ref|ZP_07472984.1| dihydrodipicolinate reductase [Brucella sp. BO2]
 gi|306289814|gb|EFM60993.1| dihydrodipicolinate reductase [Brucella sp. BO2]
          Length = 279

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 183/267 (68%), Gaps = 2/267 (0%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +D+
Sbjct: 12  MGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAITDD 71

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                    G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A IVK
Sbjct: 72  PLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATIVK 131

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 132 SGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARGRD 190

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR IF
Sbjct: 191 IALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRSIF 250

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA  + PGLYSM DVLG+
Sbjct: 251 ARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|62317878|ref|YP_223731.1| dihydrodipicolinate reductase [Brucella abortus bv. 1 str. 9-941]
 gi|83269856|ref|YP_419147.1| dihydrodipicolinate reductase [Brucella melitensis biovar Abortus
           2308]
 gi|256015810|ref|YP_003105819.1| dihydrodipicolinate reductase [Brucella microti CCM 4915]
 gi|75495347|sp|Q576R4|DAPB_BRUAB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|90101229|sp|Q2YJN7|DAPB_BRUA2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|62198071|gb|AAX76370.1| DapB, dihydrodipicolinate reductase [Brucella abortus bv. 1 str.
           9-941]
 gi|82940130|emb|CAJ13178.1| Eukaryotic thiol (cysteine) protease:Dihydrodipicolinate reductase
           [Brucella melitensis biovar Abortus 2308]
 gi|255998470|gb|ACU50157.1| dihydrodipicolinate reductase [Brucella microti CCM 4915]
          Length = 268

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 183/267 (68%), Gaps = 2/267 (0%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +D+
Sbjct: 1   MGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                    G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A IVK
Sbjct: 61  PLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARGRD 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR IF
Sbjct: 180 IALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA  + PGLYSM DVLG+
Sbjct: 240 ARGAIKAALWAHGKKPGLYSMLDVLGL 266


>gi|294854002|ref|ZP_06794674.1| dihydrodipicolinate reductase [Brucella sp. NVSL 07-0026]
 gi|294819657|gb|EFG36657.1| dihydrodipicolinate reductase [Brucella sp. NVSL 07-0026]
          Length = 279

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 184/270 (68%), Gaps = 2/270 (0%)

Query: 3   QSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
            S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  
Sbjct: 9   NSEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAI 68

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           +++         G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A 
Sbjct: 69  TNDPLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHAT 128

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           IVKS NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A 
Sbjct: 129 IVKSGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAAR 187

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR
Sbjct: 188 GRDIALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDR 247

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 248 SIFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|17988593|ref|NP_541226.1| dihydrodipicolinate reductase [Brucella melitensis bv. 1 str. 16M]
 gi|256043917|ref|ZP_05446835.1| dihydrodipicolinate reductase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565093|ref|ZP_05835578.1| dihydrodipicolinate reductase [Brucella melitensis bv. 1 str. 16M]
 gi|265990338|ref|ZP_06102895.1| dihydrodipicolinate reductase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17984393|gb|AAL53490.1| dihydrodipicolinate reductase [Brucella melitensis bv. 1 str. 16M]
 gi|260152736|gb|EEW87829.1| dihydrodipicolinate reductase [Brucella melitensis bv. 1 str. 16M]
 gi|263001007|gb|EEZ13697.1| dihydrodipicolinate reductase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 279

 Score =  268 bits (685), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 139/269 (51%), Positives = 183/269 (68%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +
Sbjct: 10  SEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAIT 69

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A I
Sbjct: 70  DDPLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATI 129

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A G
Sbjct: 130 VKSGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARG 188

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L D+ V  R      R  G+IG A+LR GS++G+HSV++A  GE + LSH A DR 
Sbjct: 189 RDIALADNSVRVRDGYTGPRETGTIGFATLRGGSVIGDHSVILADTGERVVLSHHAEDRS 248

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 249 IFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|225686805|ref|YP_002734777.1| dihydrodipicolinate reductase [Brucella melitensis ATCC 23457]
 gi|256111017|ref|ZP_05452079.1| dihydrodipicolinate reductase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256262061|ref|ZP_05464593.1| dihydrodipicolinate reductase [Brucella melitensis bv. 2 str. 63/9]
 gi|265992553|ref|ZP_06105110.1| dihydrodipicolinate reductase [Brucella melitensis bv. 3 str.
           Ether]
 gi|225642910|gb|ACO02823.1| dihydrodipicolinate reductase [Brucella melitensis ATCC 23457]
 gi|262763423|gb|EEZ09455.1| dihydrodipicolinate reductase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263091751|gb|EEZ16082.1| dihydrodipicolinate reductase [Brucella melitensis bv. 2 str. 63/9]
 gi|326411212|gb|ADZ68276.1| dihydrodipicolinate reductase [Brucella melitensis M28]
 gi|326554503|gb|ADZ89142.1| dihydrodipicolinate reductase [Brucella melitensis M5-90]
          Length = 279

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 139/269 (51%), Positives = 183/269 (68%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +
Sbjct: 10  SEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAIT 69

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A I
Sbjct: 70  DDPLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATI 129

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A G
Sbjct: 130 VKSGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARG 188

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L D+ V  R      R  G+IG A+LR GS++G+HSV++A  GE + LSH A DR 
Sbjct: 189 RDIALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILADTGERVVLSHHAEDRS 248

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 249 IFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|256058790|ref|ZP_05449006.1| dihydrodipicolinate reductase [Brucella neotomae 5K33]
 gi|261322728|ref|ZP_05961925.1| dihydrodipicolinate reductase [Brucella neotomae 5K33]
 gi|261298708|gb|EEY02205.1| dihydrodipicolinate reductase [Brucella neotomae 5K33]
          Length = 279

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 139/269 (51%), Positives = 182/269 (67%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +
Sbjct: 10  SEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAIT 69

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A I
Sbjct: 70  DDPLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATI 129

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMS G+N L  LV+ AAE L P +D+D EILEMHHR K+D PSGTALLLGEA A G
Sbjct: 130 VKSGNMSRGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDGPSGTALLLGEAAARG 188

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR 
Sbjct: 189 RDIALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRS 248

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 249 IFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|23500773|ref|NP_700213.1| dihydrodipicolinate reductase [Brucella suis 1330]
 gi|38257620|sp|Q8FV07|DAPB_BRUSU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|23464429|gb|AAN34218.1| dihydrodipicolinate reductase [Brucella suis 1330]
          Length = 268

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/267 (51%), Positives = 182/267 (68%), Gaps = 2/267 (0%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +D+
Sbjct: 1   MGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                    G++DF+SPA +++   ++AQ  IVH+ GTTG S +++E I + AR+A IVK
Sbjct: 61  PLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVTGTTGCSAEDDEKIRAAARHATIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARGRD 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR IF
Sbjct: 180 IALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA  + PGLYSM DVLG+
Sbjct: 240 ARGAIKAALWAHGKKPGLYSMLDVLGL 266


>gi|90420657|ref|ZP_01228563.1| dihydrodipicolinate reductase [Aurantimonas manganoxydans SI85-9A1]
 gi|90334948|gb|EAS48709.1| dihydrodipicolinate reductase [Aurantimonas manganoxydans SI85-9A1]
          Length = 269

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 136/269 (50%), Positives = 178/269 (66%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +PM++ VLG  GRMG+ L+  I       L   + R GS  IGQD G   GI   G+  +
Sbjct: 2   APMKLVVLGAAGRMGRTLVTVISETEGAVLSGAVEREGSEAIGQDAGLLAGIGTSGVLIT 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++  A+   DGIIDF++PA ++     +A  ++VH++GTTG S  ++  I++ A   PI
Sbjct: 62  DDIDAALAGADGIIDFTAPAASVAMAERAASGSLVHVVGTTGCSTDQDAAIAASAERTPI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LVE AA  L P   +D EILEMHH+ K+D+PSGTALLLGEA A G
Sbjct: 122 VKSGNMSLGVNLLAGLVEKAARALGP-DAFDIEILEMHHKHKVDAPSGTALLLGEAAAKG 180

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R ++L D  V  R      R EG+IG A+LR GS+ GEHSV++AGEGE I +SH A DR 
Sbjct: 181 RGISLADKSVRVRDGHTGPRPEGTIGFATLRGGSVTGEHSVILAGEGERIEISHLATDRA 240

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWAK + PGLY+M DVLG+
Sbjct: 241 IFARGAVRAALWAKDRAPGLYTMADVLGL 269


>gi|306846252|ref|ZP_07478814.1| dihydrodipicolinate reductase [Brucella sp. BO1]
 gi|306273503|gb|EFM55364.1| dihydrodipicolinate reductase [Brucella sp. BO1]
          Length = 279

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 137/269 (50%), Positives = 183/269 (68%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +
Sbjct: 10  SEMGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAIT 69

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+         G++DF+SPA +++   ++AQ  IVH+IGTTG S ++++ I +  R+A I
Sbjct: 70  DDPLPVFAKAQGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDDKIRAAGRHATI 129

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+ AA+ L P +D+D EILEMHHR K+D+PSGTALLLGEA A G
Sbjct: 130 VKSGNMSLGVNLLSVLVQKAAQALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARG 188

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L D+ V  R      R  G+IG A+LR GS++G+HSV++AG GE + LSH A DR 
Sbjct: 189 RDIALADNSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGAGERVVLSHHAEDRS 248

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA  + PGLYSM DVLG+
Sbjct: 249 IFARGAIKAALWAHGKKPGLYSMLDVLGL 277


>gi|20978450|sp|Q8YDC8|DAPB_BRUME RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
          Length = 268

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 138/267 (51%), Positives = 182/267 (68%), Gaps = 2/267 (0%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M + V+G GGRMGQ LI+ I +     L   I RSGSP +G+D G   GI  +G+  +D+
Sbjct: 1   MGLVVVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                    G++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A IVK
Sbjct: 61  PLPVFAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+ AAE L P +D+D EILEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLSVLVQKAAEALGP-EDFDIEILEMHHRHKVDAPSGTALLLGEAAARGRD 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L D+ V  R      R  G+IG A+LR GS++G+HSV++A  GE + LSH A DR IF
Sbjct: 180 IALADNSVRVRDGYTGPRETGTIGFATLRGGSVIGDHSVILADTGERVVLSHHAEDRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA  + PGLYSM DVLG+
Sbjct: 240 ARGAIKAALWAHGKKPGLYSMLDVLGL 266


>gi|298290339|ref|YP_003692278.1| dihydrodipicolinate reductase [Starkeya novella DSM 506]
 gi|296926850|gb|ADH87659.1| dihydrodipicolinate reductase [Starkeya novella DSM 506]
          Length = 271

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 180/269 (66%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + MR+ V+G  GRMG+ LI+ +   P + L   I + GS  IG+D G   G+ P+G+K S
Sbjct: 2   TQMRLVVVGASGRMGRVLIRAVDEAPDLLLVGAIDQPGSEFIGRDAGELAGLPPLGVKIS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+      + DG+IDF+ P  T+    ++AQ  IVH+IGTTGFS ++ E I++ +R+A I
Sbjct: 62  DDALTHFAAADGVIDFTVPQATVGYAALAAQARIVHVIGTTGFSPEDEEKIAAASRHAAI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV   A  L   + +D E+LEMHH RK+D+PSGTALLLG+A A G
Sbjct: 122 VKSGNMSLGVNLLAALVRRVARTL--DEGFDIEVLEMHHNRKIDAPSGTALLLGQAAAQG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V L ++ V  RH    AR  G IG A+LR GS+VGEH+V+ AG+ E I L+H A DR 
Sbjct: 180 RGVTLEENGVFTRHGHTGARKAGDIGFATLRGGSVVGEHNVIFAGQAERIELAHKAEDRG 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG+L AA WA+ + PGLYSM DVLG+
Sbjct: 240 IFARGALAAARWARGRKPGLYSMADVLGL 268


>gi|153008661|ref|YP_001369876.1| dihydrodipicolinate reductase [Ochrobactrum anthropi ATCC 49188]
 gi|151560549|gb|ABS14047.1| Dihydrodipicolinate reductase [Ochrobactrum anthropi ATCC 49188]
          Length = 277

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 133/257 (51%), Positives = 176/257 (68%), Gaps = 1/257 (0%)

Query: 15  RMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDG 74
           RMGQ LI+ I       L   I RS SPL+G+D G   GI P+G+  +D+         G
Sbjct: 20  RMGQTLIRTIQTIEGAKLVGAIERSSSPLLGRDAGEVTGIGPLGVTITDDPLPVFAKAQG 79

Query: 75  IIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINF 134
           ++DF+SPA +++   ++AQ  IVH+IGTTG S +++E I + AR+A IVKS NMSLG+N 
Sbjct: 80  VLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATIVKSGNMSLGVNL 139

Query: 135 LGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLN 194
           L  LV+ AA+ L PA D+D EILEMHH+ K+D+PSGTALLLGEA A GR + L ++ V  
Sbjct: 140 LSVLVQKAAQALDPA-DFDIEILEMHHKHKVDAPSGTALLLGEAAAKGRDIALAENSVRV 198

Query: 195 RHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALW 254
           R      R  GSIG A+LR GS++G+HSV++AG GE + LSH A DR +FARG++ AALW
Sbjct: 199 RDGYTGPRETGSIGFATLRGGSVIGDHSVILAGPGERVVLSHHAEDRSVFARGAIKAALW 258

Query: 255 AKSQIPGLYSMRDVLGI 271
           A  + PGLYSM DVLG+
Sbjct: 259 AHGKKPGLYSMLDVLGL 275


>gi|163757719|ref|ZP_02164808.1| dihydrodipicolinate reductase [Hoeflea phototrophica DFL-43]
 gi|162285221|gb|EDQ35503.1| dihydrodipicolinate reductase [Hoeflea phototrophica DFL-43]
          Length = 276

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 173/264 (65%), Gaps = 1/264 (0%)

Query: 8   ISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAM 67
           I V   GRMGQ+LI+ I       L   I R GS  +G+D G   G+ P G+  +D+   
Sbjct: 11  IVVGAAGRMGQSLIRAITEIDGAHLAGAIERPGSAALGKDAGELAGVGPNGVAITDDALT 70

Query: 68  AIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSN 127
                +G++DF++PA TL+   ++AQ  IVH+IGTTG    +   + + +R+A IVKS N
Sbjct: 71  VFAKAEGVLDFTAPAATLEFAELAAQARIVHVIGTTGMGESDEAKLHAASRHARIVKSGN 130

Query: 128 MSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNL 187
           MSLG+N L  LV  AA+ L  A DWD E+LEMHHR K+D+PSGTALLLGEA A GR + L
Sbjct: 131 MSLGVNLLSVLVRQAAKAL-AAGDWDIEVLEMHHRHKVDAPSGTALLLGEAAAEGRDIGL 189

Query: 188 TDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARG 247
             H V  R      R  G+IG A+LR GS+VGEHSV+IAGEGE++ L+H A DR IFARG
Sbjct: 190 GQHSVRVRDGHTGPREPGTIGFATLRGGSVVGEHSVIIAGEGETVELTHKATDRSIFARG 249

Query: 248 SLTAALWAKSQIPGLYSMRDVLGI 271
           ++ AALWA+ Q PG YSM DVLG+
Sbjct: 250 AVRAALWARPQKPGYYSMLDVLGL 273


>gi|325291624|ref|YP_004277488.1| Dihydrodipicolinate reductase [Agrobacterium sp. H13-3]
 gi|325059477|gb|ADY63168.1| Dihydrodipicolinate reductase [Agrobacterium sp. H13-3]
          Length = 275

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 188/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S M++ V+G  GRMGQALI+ IH  P +TLH+ + R GS  +G+D G   G+ P+GI
Sbjct: 1   MSGSDMKLVVVGAAGRMGQALIRLIHQTPGVTLHATVAREGSAFVGRDAGEIAGLGPIGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K + +   A    +G+IDF+SPA ++    ++AQ  IVH+IGTTG S+ + E   + +R+
Sbjct: 61  KITSDPLQAFLHAEGVIDFTSPATSVTFAGLAAQARIVHVIGTTGCSLGDEEKFKAASRH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  L + AA+ L  A++WD EILEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARIVKSGNMSLGVNLLSVLTQQAAKAL-DAQNWDIEILEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GRKV+L    V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE + LSH A 
Sbjct: 180 AAGRKVDLATSSVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVIFAGEGERVELSHYAG 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++ AA+WA  + PG YSM DVLG+
Sbjct: 240 DRSIFARGAIAAAVWAFDKKPGFYSMLDVLGL 271


>gi|312113454|ref|YP_004011050.1| dihydrodipicolinate reductase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218583|gb|ADP69951.1| dihydrodipicolinate reductase [Rhodomicrobium vannielii ATCC 17100]
          Length = 265

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 182/267 (68%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++++G  GRMG+ALI+ IH  P+  +   + R+GSP IG+D G   G+ P+G++ + +
Sbjct: 1   MRLAIMGAAGRMGRALIRTIHETPNCDVSGAVERAGSPFIGKDAGEIAGVGPLGVEITSD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                  VDG++DF++PA ++++  ++AQ  IVH+IGTTGFS  +   I + AR+A I+K
Sbjct: 61  AISLFTHVDGVLDFTTPAASVETAGLAAQARIVHVIGTTGFSPDDEAKIEAAARHATIIK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L              + +D EI+EMHH+ K+D+PSGTALLLGEA A+GR 
Sbjct: 121 SGNMSLGVNLL--AALVEKAAAALDERFDIEIIEMHHKHKVDAPSGTALLLGEAAADGRH 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L DH +  R      R  G+IG A+LR GS+VG+HSV+ AG GE I LSH A DR+IF
Sbjct: 179 IQLADHKITAREGHTGERPLGAIGFAALRGGSVVGDHSVIFAGTGERIELSHRAEDRQIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALW + + PGL+SMR+VLG+
Sbjct: 239 ARGAVAAALWGQGKGPGLFSMRNVLGL 265


>gi|118590506|ref|ZP_01547908.1| dihydrodipicolinate reductase [Stappia aggregata IAM 12614]
 gi|118436969|gb|EAV43608.1| dihydrodipicolinate reductase [Stappia aggregata IAM 12614]
          Length = 256

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 176/256 (68%), Gaps = 2/256 (0%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+AL + + + P  T+ + I R GS  +G+DVG   G  P+G+  +D+   A  + DG+
Sbjct: 1   MGRALTRAVTDTPGATVVAAIEREGSEFLGKDVGELAGTGPLGVPVTDDPLTAFAASDGV 60

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           +DF++PA +L    ++AQ  IVH+IGTTG++  ++E + + AR+A IVKS NMSLG+N L
Sbjct: 61  LDFTTPAASLWFAELAAQARIVHVIGTTGWAEGQDEPLQAAARHARIVKSGNMSLGVNLL 120

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             LV  AA  L    D+D E+LEMHH+ K+D+PSGTALLLGEA A+GR ++LT H V +R
Sbjct: 121 ASLVRKAAAAL--DTDFDIEVLEMHHKHKVDAPSGTALLLGEAAADGRGIDLTAHSVRSR 178

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                 R  G IG A+LR GS++GEHSV+ AGEGE I L+H A DR++FARG++ AALW 
Sbjct: 179 DGIMDPRRTGDIGFATLRGGSVIGEHSVIFAGEGERIELTHRAEDRQLFARGAVKAALWG 238

Query: 256 KSQIPGLYSMRDVLGI 271
             Q PG YSM DVLG+
Sbjct: 239 FDQKPGFYSMADVLGL 254


>gi|307942754|ref|ZP_07658099.1| dihydrodipicolinate reductase [Roseibium sp. TrichSKD4]
 gi|307773550|gb|EFO32766.1| dihydrodipicolinate reductase [Roseibium sp. TrichSKD4]
          Length = 270

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 181/267 (67%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI+V+G  GRMG+ALI+ + + P + L   + R GS  +GQD+G   G+  +GI  SD+
Sbjct: 4   MRIAVVGAAGRMGKALIQAVWSTPGVCLSGGVEREGSHALGQDLGEIAGVGHLGIPISDD 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                 + DG++DF++P  +L    ++AQ  I HIIGTTG++  ++E + + AR+A IVK
Sbjct: 64  PLTVFANTDGVLDFTAPQASLAFAELAAQARIAHIIGTTGWTEGQDEPLKAAARHARIVK 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV  AA  L    D+D E+LEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 124 SGNMSLGVNLLANLVRKAAAAL--DTDFDIEVLEMHHRHKVDAPSGTALLLGEAAAEGRT 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           +NL +  V  R     AR EG+IG A+LR GS++GEHSV+ A +GE I L+H A DR +F
Sbjct: 182 INLEEKSVRVRDGITGAREEGTIGFATLRGGSVIGEHSVIFAADGERIELAHKAEDRSLF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AALWA  + PG YSM DVLG+
Sbjct: 242 AKGAVKAALWAFDKKPGYYSMADVLGL 268


>gi|217979085|ref|YP_002363232.1| dihydrodipicolinate reductase [Methylocella silvestris BL2]
 gi|254767053|sp|B8EIQ3|DAPB_METSB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|217504461|gb|ACK51870.1| Dihydrodipicolinate reductase [Methylocella silvestris BL2]
          Length = 272

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 174/268 (64%), Gaps = 3/268 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V G  GRMG+ L++ +   P   +   + R+ SP IGQD G   G   +G+K S +
Sbjct: 4   MRLVVAGAAGRMGRVLVQIVQQTPGAMVSGALARADSPAIGQDAGVLAGCGEIGVKISTD 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A+   DG++DF+SPA T+    ++AQ  +VH+IGTTG S +    + + AR+A IV+
Sbjct: 64  PLRAVADCDGVLDFTSPASTMVLATLAAQARVVHVIGTTGLSPEHLARLDAAARHAVIVQ 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LVE AA  L P  ++D EI EMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 124 SGNMSLGVNLLAALVEKAARTLGP--EFDIEIAEMHHRAKVDAPSGTALLLGEAAAKGRN 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           ++L  H +  R     AR EG+IG ASLR G +VGEH V  AG GE + L+H A DR IF
Sbjct: 182 IDLPSHSLRARDGHTGARPEGAIGFASLRGGGVVGEHKVYFAGAGERLELAHVAEDRSIF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           ARG++ AALW + +  GLYSM DVLG+G
Sbjct: 242 ARGAVKAALWGRGRKSGLYSMADVLGLG 269


>gi|163868928|ref|YP_001610155.1| dihydrodipicolinate reductase [Bartonella tribocorum CIP 105476]
 gi|189082789|sp|A9IXE5|DAPB_BART1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|161018602|emb|CAK02160.1| Dihydrodipicolinate reductase [Bartonella tribocorum CIP 105476]
          Length = 270

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 175/267 (65%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  GRMG+ LI  I     + L +++VR  SP +G+D    +G   +GI+ +D+
Sbjct: 1   MRLTVVGANGRMGRELITAIRQRKDVELCAVLVRKNSPFVGKDASVLIGSDSLGIRITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  S +GI+DFS P  +L   + +AQ  +VHIIGTTGFS  E E I+ FA+   IVK
Sbjct: 61  PENAFSSTEGIVDFSHPQASLLYADYAAQKKLVHIIGTTGFSKTEEEKIAEFAKYTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGIN L  LV+ AA+  L A D+D EI EMHH  K+D+PSGTALLLG+A A GR 
Sbjct: 121 SGNMSLGINLLANLVKKAAK-ALEADDFDIEIYEMHHANKVDAPSGTALLLGQAAAEGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D  +  R+     R +GSIG +  R G+++GEHSV+ AG  E I LSH+A +R IF
Sbjct: 180 VMLQDVRINERNGYTGKREKGSIGFSCSRGGTVIGEHSVIFAGSHERIVLSHTAQERSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AA WAK+   GLYSM DVLG+
Sbjct: 240 ANGALKAASWAKNHANGLYSMLDVLGL 266


>gi|220920489|ref|YP_002495790.1| dihydrodipicolinate reductase [Methylobacterium nodulans ORS 2060]
 gi|219945095|gb|ACL55487.1| dihydrodipicolinate reductase [Methylobacterium nodulans ORS 2060]
          Length = 265

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/267 (48%), Positives = 175/267 (65%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V+G  GRMG+ LI+ +      TL   + R GS  IG+D G   G+ P+G+  +D+
Sbjct: 1   MRLVVVGASGRMGRMLIQTVVGTEGCTLAGAVAREGSAAIGEDAGVLAGLPPLGLAVTDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A    DG++DF++PA T+    ++AQ  +VH++GTTG S  + + + + +R+A IV+
Sbjct: 61  PLRAFAEADGVLDFTAPATTVFYAELAAQARLVHVVGTTGLSADDLKKLDAASRHARIVR 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV   A  L   +++D EILEMHHR K+D+PSGTALLLG+A A GR 
Sbjct: 121 SGNMSLGVNLLAGLVRKVAATL--GEEFDIEILEMHHRHKVDAPSGTALLLGKAAAEGRA 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R     AR  G+IG A+LR GS+VGEHSV+ AG GE I L+H A DR IF
Sbjct: 179 VALAERKVAVRDGHTGARVPGTIGFATLRGGSVVGEHSVIFAGAGERIELTHRAEDRGIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA  Q PGLY M DVLG+
Sbjct: 239 ARGAVRAALWAFPQKPGLYDMDDVLGL 265


>gi|240850500|ref|YP_002971899.1| dihydrodipicolinate reductase [Bartonella grahamii as4aup]
 gi|240267623|gb|ACS51211.1| dihydrodipicolinate reductase [Bartonella grahamii as4aup]
          Length = 270

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 177/267 (66%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  GRMG+ LI  I     + L +++VR GSP +G+D    +G   +GI  +D+
Sbjct: 1   MRLTVVGANGRMGRELITAIQQRRDVELCAVLVRKGSPFVGKDASALIGSDSLGIGITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  + +G++DFS P  ++   N +AQ ++VHIIGTTGFS  E E I+ FA+   IVK
Sbjct: 61  PENAFSNTEGLLDFSQPEASILYANYAAQKSLVHIIGTTGFSKTEEEKIADFAKYTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGIN L  LV+ AA+  L A D+D E+ EMHH  K+D+PSGTALLLG+A A GR 
Sbjct: 121 SGNMSLGINLLANLVKKAAK-ALGADDFDIEVYEMHHANKVDAPSGTALLLGQAAAEGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R+     R +GSIG +  R G++VGEHSV+ AG  E I LSH+A +R IF
Sbjct: 180 VMLKNVRVNERNGHIGKREKGSIGFSCSRGGTVVGEHSVIFAGSHERIILSHTAQERSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK+   GLYSM DVLG+
Sbjct: 240 ANGALKAALWAKNHENGLYSMLDVLGL 266


>gi|159184200|ref|NP_353218.2| dihydrodipicolinate reductase [Agrobacterium tumefaciens str. C58]
 gi|23813936|sp|Q8UIV8|DAPB_AGRT5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|159139530|gb|AAK86003.2| dihydrodipicolinate reductase [Agrobacterium tumefaciens str. C58]
          Length = 275

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/272 (51%), Positives = 189/272 (69%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S M++ V+G  GRMGQALI+ IH  P + LH+ + R GS  +G+D G   G+ P+GI
Sbjct: 1   MGSSGMKLVVVGAAGRMGQALIRLIHQTPGVQLHAAVAREGSAFVGRDAGEIAGLGPIGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           + + +   A    +G+IDF+SPA ++    ++AQ  IVH++GTTG S ++ E   + +R+
Sbjct: 61  EITSDPLQAFLHAEGVIDFTSPATSITFAGLAAQARIVHVVGTTGCSPQDEEKFKAASRH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  L + AA+ L  A++WD EILEMHH+ K+D+PSGTALLLGEA 
Sbjct: 121 ARIVKSGNMSLGVNLLSVLTQQAAQALD-AQNWDIEILEMHHKHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GRKV+LT   V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE + LSH A 
Sbjct: 180 AAGRKVDLTAASVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVIFAGEGERVELSHYAG 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG++TAA+WA  + PG YSM DVLG+
Sbjct: 240 DRSIFARGAITAAVWAFDKKPGFYSMLDVLGL 271


>gi|188581687|ref|YP_001925132.1| dihydrodipicolinate reductase [Methylobacterium populi BJ001]
 gi|179345185|gb|ACB80597.1| Dihydrodipicolinate reductase [Methylobacterium populi BJ001]
          Length = 267

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 174/267 (65%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ V+G  GRMG+ LI+ +      TLH  I R GSP +GQD G   GI  +G+  SD+
Sbjct: 1   MKLVVVGAEGRMGRMLIRAVAEAEGCTLHGAIERPGSPALGQDAGRLAGIGDLGVPVSDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                 + DG++DF++PA T+    ++AQ  IVHI+GTTG S  + + + + + +A IV+
Sbjct: 61  PLSRFVAADGVLDFTAPAATVAFAELAAQARIVHIVGTTGLSADDLKRLEAASYHARIVR 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV   A  L   +++D E+LEMHHR K+D+PSGTALLLGEA A GR+
Sbjct: 121 SGNMSLGVNLLAGLVRKVAATL--GEEFDIEVLEMHHRMKVDAPSGTALLLGEAAAEGRR 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R     AR  G IG A+LR GS+VG+HSV+ AG  E ITLSH A DR IF
Sbjct: 179 VALAETRVSTRDGHTGARRPGDIGFATLRGGSVVGDHSVIFAGPSERITLSHHAEDRAIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AA WA  + PGLY M DVLG+
Sbjct: 239 ARGAVRAAQWAFDKPPGLYGMDDVLGL 265


>gi|209883576|ref|YP_002287433.1| dihydrodipicolinate reductase [Oligotropha carboxidovorans OM5]
 gi|226696357|sp|B6JCI8|DAPB_OLICO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|209871772|gb|ACI91568.1| dihydrodipicolinate reductase [Oligotropha carboxidovorans OM5]
          Length = 272

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 175/270 (64%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+ LI  +H      L   +   GS L+GQD G   G+ P GI  S
Sbjct: 2   SDMRLIVAGAGGRMGRTLIHALHEADGAALVGALEAPGSELLGQDSGLLAGLGPNGIPVS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L    +  DGIIDF+ PA T+ ++ I+A+  IVH+IGTTG S  +N VI S    A +
Sbjct: 62  ADLWSLSKDADGIIDFTVPAATIANVAIAAERGIVHVIGTTGLSASDNAVIKSVTSRAIV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  LV+  A+ L   +D+D EILEMHHR K+D+PSGTA LLG+A A+G
Sbjct: 122 VQSGNMSLGVNLLAALVKQVAKSL--DEDFDIEILEMHHRAKIDAPSGTAYLLGQAAADG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V L +  V +R     AR  G IG A+LR G++ GEHSV+ AG  E I L+H A DR 
Sbjct: 180 RGVPLEEKSVRSRDGFTGARGRGDIGFATLRGGTVTGEHSVIFAGPYERIELTHRAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IFARG++ AA WA+ + PGLYSM DVLG+G
Sbjct: 240 IFARGAVKAACWARGRKPGLYSMADVLGLG 269


>gi|154254002|ref|YP_001414826.1| dihydrodipicolinate reductase [Parvibaculum lavamentivorans DS-1]
 gi|171769689|sp|A7HZ36|DAPB_PARL1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|154157952|gb|ABS65169.1| Dihydrodipicolinate reductase [Parvibaculum lavamentivorans DS-1]
          Length = 271

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 137/270 (50%), Positives = 174/270 (64%), Gaps = 4/270 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGIS-PMGIKF 61
           + ++I V G  GRMG+ LI+ IH    ++L   +   GSP +G D+G   G++ P G+  
Sbjct: 3   ADIKIVVTGAAGRMGRTLIRLIHETEGLSLAGGLEGEGSPYLGTDLGTLAGLAQPTGLAA 62

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           + +    I+  D +IDFS PA TL+   ++AQ  IVH+IGTTGF V + E I + AR+A 
Sbjct: 63  TADALTLIKDADALIDFSVPAATLEFAALAAQARIVHVIGTTGFEVVDEEKIKAAARHAT 122

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           IVK+ NMSLG+N L  LV  AA+ L     WD EI+EMHHR K+D+PSGTALLLGEA A 
Sbjct: 123 IVKAGNMSLGVNLLAALVRQAAKAL--DGQWDIEIVEMHHRHKVDAPSGTALLLGEAAAE 180

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR V L D     R     AR  G IG ASLR GS+VG+H+VV A E E ITL H A DR
Sbjct: 181 GRGVALEDVSARGRDGITGARKAGDIGFASLRGGSVVGDHTVVFATEHERITLGHIAEDR 240

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            IFARG+L AA W + + PGL+SM DVLGI
Sbjct: 241 SIFARGALKAARWGQGKGPGLFSMADVLGI 270


>gi|25284508|pir||AI2598 dihydrodipicolinate reductase [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)
          Length = 270

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 187/267 (70%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ V+G  GRMGQALI+ IH  P + LH+ + R GS  +G+D G   G+ P+GI+ + +
Sbjct: 1   MKLVVVGAAGRMGQALIRLIHQTPGVQLHAAVAREGSAFVGRDAGEIAGLGPIGIEITSD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A    +G+IDF+SPA ++    ++AQ  IVH++GTTG S ++ E   + +R+A IVK
Sbjct: 61  PLQAFLHAEGVIDFTSPATSITFAGLAAQARIVHVVGTTGCSPQDEEKFKAASRHARIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  L + AA+ L  A++WD EILEMHH+ K+D+PSGTALLLGEA A GRK
Sbjct: 121 SGNMSLGVNLLSVLTQQAAQALD-AQNWDIEILEMHHKHKVDAPSGTALLLGEAAAAGRK 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V+LT   V  R     AR  G+IG A+LR GS++GEHSV+ AGEGE + LSH A DR IF
Sbjct: 180 VDLTAASVRVRDGHTGAREAGTIGFATLRGGSVIGEHSVIFAGEGERVELSHYAGDRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++TAA+WA  + PG YSM DVLG+
Sbjct: 240 ARGAITAAVWAFDKKPGFYSMLDVLGL 266


>gi|316931681|ref|YP_004106663.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris DX-1]
 gi|315599395|gb|ADU41930.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris DX-1]
          Length = 271

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 132/270 (48%), Positives = 170/270 (62%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL + I     + L   +    S L+GQD G   G+   G+  S
Sbjct: 2   SEMRLIVAGAGGRMGRALTRAISETDGVVLTGALESPNSELLGQDAGTLAGLPANGVLLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L     + DGI+DF+ P  T+ ++ I+AQ  I HIIGTTG S  +N VI S    A +
Sbjct: 62  ADLWSLSANADGIVDFTVPQATIANVAIAAQRGIAHIIGTTGLSASDNAVIQSVTNRAVV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  + +  A+ L     +D EI+EMHHR K+D+PSGTALLLGEA+A G
Sbjct: 122 VKSGNMSLGVNLLAAIAKRVAQSL--DDSFDIEIVEMHHRAKVDAPSGTALLLGEAVAAG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           RK++L  H    R     AR  G IG ASLR G++ G+H+V+ AG  E I L+H A DR 
Sbjct: 180 RKIDLATHSARGRDGLTGARKPGDIGFASLRGGTVTGDHTVIFAGASERIELTHKAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IFA G+LTAA WA+ Q PGLYSM DVLG+G
Sbjct: 240 IFAHGALTAARWARGQKPGLYSMADVLGLG 269


>gi|182677133|ref|YP_001831279.1| dihydrodipicolinate reductase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|238691212|sp|B2IBR8|DAPB_BEII9 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|182633016|gb|ACB93790.1| Dihydrodipicolinate reductase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 271

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 131/270 (48%), Positives = 176/270 (65%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +++ V G  GRMG+ LI+       +T+ + + R GS  +GQD G   G   + +  +
Sbjct: 2   SELKLVVAGAAGRMGRVLIQTAIETSGVTVSAALARPGSLALGQDAGLLAGCGEINVPIT 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           ++   AI   DGI+DF+SP L+++   ++AQ  IVHIIGTTGFSV     I + AR+A I
Sbjct: 62  EDALAAIVDADGILDFTSPDLSVELAALAAQARIVHIIGTTGFSVAHLTKIEAAARHAVI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  LV+  A  L P   +D EI EMHHR K+D+PSGTALLLGEA A G
Sbjct: 122 VRSGNMSLGVNLLAALVKKTAAVLGPV--YDIEIAEMHHRMKVDAPSGTALLLGEAAAQG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R ++L++H    R      R +G IG  SLR G++VG+H+V+ AG GE I L+H A DRR
Sbjct: 180 RGISLSEHEQRGRDGHTGPRKDGDIGFVSLRGGTVVGDHTVIFAGPGERIELAHRAEDRR 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IF RG++ AALW K + PGLYSM DVLG+G
Sbjct: 240 IFGRGAVQAALWGKGRKPGLYSMLDVLGLG 269


>gi|110635918|ref|YP_676126.1| dihydrodipicolinate reductase [Mesorhizobium sp. BNC1]
 gi|122965509|sp|Q11CB4|DAPB_MESSB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|110286902|gb|ABG64961.1| dihydrodipicolinate reductase [Chelativorans sp. BNC1]
          Length = 277

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 134/259 (51%), Positives = 172/259 (66%), Gaps = 1/259 (0%)

Query: 13  GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSV 72
           GGRMGQ LI+ +H    + +   I RSGSP +G+D G   GI  + ++  D         
Sbjct: 12  GGRMGQTLIRTVHAMEGVRVVGAIERSGSPHLGRDAGELAGIGIINVEICDEPLSVFAKA 71

Query: 73  DGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGI 132
           DG++DF++P  T++    +AQ  IVH+IGTTG S ++   I++ AR+A IVKS NMSLG+
Sbjct: 72  DGVLDFTTPKATVEFAGYAAQARIVHVIGTTGLSGEDEAAIAAAARHATIVKSGNMSLGV 131

Query: 133 NFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMV 192
           N L  LV+ AA  L  A D+D EILEMHHR K+D+PSGTALLLGEA A GR + L D  V
Sbjct: 132 NLLSVLVKQAARAL-DAADFDIEILEMHHRHKVDAPSGTALLLGEAAAEGRAIELADKSV 190

Query: 193 LNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAA 252
             R      R  G+IG A+LR GS+VGEHSV++AG GE I LSH A DR IFARG++ AA
Sbjct: 191 RVRDGHTGPREAGTIGFATLRGGSVVGEHSVILAGIGERIVLSHLAEDRTIFARGAVKAA 250

Query: 253 LWAKSQIPGLYSMRDVLGI 271
           LWA+ + PGL+SM DVLG 
Sbjct: 251 LWARGRKPGLHSMLDVLGF 269


>gi|121601966|ref|YP_989326.1| dihydrodipicolinate reductase [Bartonella bacilliformis KC583]
 gi|166222614|sp|A1UTM3|DAPB_BARBK RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|120614143|gb|ABM44744.1| dihydrodipicolinate reductase [Bartonella bacilliformis KC583]
          Length = 268

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V+G  GRMG+ LI    N   I L  ++VR  SP +GQDV   +G +P+GI+ +D+
Sbjct: 1   MRLVVVGANGRMGRELITACQNREDIELSGVLVREKSPFVGQDVSILIGSAPLGIRITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  + DGI+DFS P  ++   + +AQ  +VHIIGTTGFS +E+  I+  A    IVK
Sbjct: 61  PENAFSNADGIVDFSQPQASVIHADYAAQKGLVHIIGTTGFSKEEDAQIAISATRTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L   V+ AA+  L A D+D EI EMHH +K+D+PSGTALLLG A A GR 
Sbjct: 121 SENMSLGVNLLANFVKKAAK-ALGAHDFDIEICEMHHSKKVDAPSGTALLLGNAAAEGRH 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +     R+     R +G+IG A LR G+++G+HSV+ AG  E IT SHSA +R IF
Sbjct: 180 VALKEVSASGRNGYTGERKKGTIGFACLRGGTVIGDHSVIFAGLNERITFSHSAQERSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A G+L AALWAK+   GLYSM DVL
Sbjct: 240 AHGALKAALWAKNYKNGLYSMLDVL 264


>gi|319408963|emb|CBI82620.1| Dihydrodipicolinate reductase [Bartonella schoenbuchensis R1]
          Length = 268

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 175/267 (65%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  GRMG+ALI  + +   + L  ++VR GSP +G+D    +G + +GI  +D+
Sbjct: 1   MRLAVVGANGRMGRALITALQHKKGVELCGVLVRKGSPFVGKDASVLIGSNLLGIPITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A    +GI+DFS P  T+   + +AQ  IVHIIGTTGF+ +E   I+  A +  IVK
Sbjct: 61  PEKAFSDAEGILDFSQPQATIIYADYAAQKGIVHIIGTTGFTKEEEAQIAISAMHTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGIN L  LV+ AA+  L ++D+D EI EMHH  K+D+PSGTALLLG A A GR 
Sbjct: 121 SGNMSLGINLLANLVKKAAK-TLTSEDFDIEISEMHHSGKVDAPSGTALLLGNAAAEGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V   D  V  R     AR +G+IG A LR G++VG+HSV+ AG  E I LSHSA +R IF
Sbjct: 180 VQFQDVYVSERKSSTGARKKGTIGFACLRGGTVVGDHSVIFAGPNEHIVLSHSAQERSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK+   GLYSM DVL +
Sbjct: 240 ANGALKAALWAKNHKNGLYSMLDVLNL 266


>gi|39933416|ref|NP_945692.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris CGA009]
 gi|192288773|ref|YP_001989378.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris TIE-1]
 gi|81564319|sp|Q6NCX8|DAPB_RHOPA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|229699952|sp|B3Q978|DAPB_RHOPT RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|39647262|emb|CAE25783.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris CGA009]
 gi|192282522|gb|ACE98902.1| Dihydrodipicolinate reductase [Rhodopseudomonas palustris TIE-1]
          Length = 271

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 131/270 (48%), Positives = 170/270 (62%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL + I     + L   +    S L+G+D G   G+   G+  S
Sbjct: 2   SEMRLIVAGAGGRMGRALTRAISETEGVVLTGALESPNSELLGKDAGTLAGLPANGVLLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L     + DGI+DF+ P  T+ ++ I+AQ  I HIIGTTG S  +N VI S    A +
Sbjct: 62  ADLWSLSANADGIVDFTVPQATIANVAIAAQRGIAHIIGTTGLSTSDNAVIQSVTDRAVV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  + +  A+ L     +D EI+EMHHR K+D+PSGTALLLGEA+A G
Sbjct: 122 VKSGNMSLGVNLLAAIAKRVAQSL--DDSFDIEIVEMHHRAKVDAPSGTALLLGEAVAAG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           RK++L  H    R     AR  G IG ASLR G++ G+H+V+ AG  E I L+H A DR 
Sbjct: 180 RKIDLATHSARGRDGFTGARKPGDIGFASLRGGTVTGDHTVIFAGASERIELTHKAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IFA G+LTAA WAK + PGLYSM DVLG+G
Sbjct: 240 IFAHGALTAARWAKGKKPGLYSMADVLGLG 269


>gi|328545911|ref|YP_004306020.1| dihydrodipicolinate reductase protein [polymorphum gilvum
           SL003B-26A1]
 gi|326415651|gb|ADZ72714.1| Dihydrodipicolinate reductase protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 256

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 175/256 (68%), Gaps = 2/256 (0%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+AL++ +     + + + I R GS  +G+D G   G+ P+G++ +D+   A  + +G+
Sbjct: 1   MGRALVRALTEMDGVAVSAAIEREGSLDLGRDAGELAGVGPIGVRLTDDPLTAFAAAEGV 60

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           +DF++P  +L    ++AQ  IVH+IGTTG+   ++  + + AR+A IVKS NMSLGIN L
Sbjct: 61  LDFTAPRASLAFAELAAQARIVHVIGTTGWQDGDSAPLKAAARHARIVKSGNMSLGINLL 120

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             LV  AA  L   +D+D EI+EMHHR K+D+PSGTALLLGEA A GR + L +  V  R
Sbjct: 121 AALVRKAATAL--DEDFDIEIVEMHHRHKVDAPSGTALLLGEAAAQGRWIPLAERSVRVR 178

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                 R +G IG A+LR GS+VG+H+V++AG+GE I L+H A DR+IFARG++ AALWA
Sbjct: 179 DGHTGPRHKGDIGFATLRGGSVVGDHTVILAGQGERIELTHRAEDRQIFARGAVKAALWA 238

Query: 256 KSQIPGLYSMRDVLGI 271
           + + PGLYSM DVLG+
Sbjct: 239 RDKKPGLYSMADVLGL 254


>gi|115522371|ref|YP_779282.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris BisA53]
 gi|122297948|sp|Q07UT2|DAPB_RHOP5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|115516318|gb|ABJ04302.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris BisA53]
          Length = 273

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 131/270 (48%), Positives = 173/270 (64%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+ALI+ I  +   T+   +    S  +G+D G   G+   G+K S
Sbjct: 2   SDMRLIVAGAGGRMGRALIRAITESAGATIVGALEAPTSKWLGEDAGTLAGLPANGVKLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L       DGI+DF+ PA TL ++ I+AQ  +VH+IGTTG S  ++ VI S    A +
Sbjct: 62  ADLWALSADADGILDFTVPAATLANVAIAAQRGLVHVIGTTGLSASDDAVIKSVTNQAVV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+  A+ L    ++D EI+EMHH+ K+D+PSGTALLLGEA A G
Sbjct: 122 VKSGNMSLGVNLLAALVKQVAKSL--DDNFDIEIVEMHHKAKVDAPSGTALLLGEAAAWG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R ++L  H    R     AR  G IG ASLR G++ G+H+V+ AG  E I L+H A DR 
Sbjct: 180 RGIDLNAHSARGRDGVTGARRAGDIGFASLRGGTVTGDHTVIFAGPYERIELTHKAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IFA G+L AALWA+ + PGLYSM DVLG+G
Sbjct: 240 IFANGALKAALWARGRAPGLYSMADVLGLG 269


>gi|254470869|ref|ZP_05084272.1| dihydrodipicolinate reductase [Pseudovibrio sp. JE062]
 gi|211960011|gb|EEA95208.1| dihydrodipicolinate reductase [Pseudovibrio sp. JE062]
          Length = 278

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 179/269 (66%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V+G  GRMG+ L++ ++    + + + I R  S  +G+D G       +G+  +
Sbjct: 9   SDMRLVVVGAAGRMGRTLVRTVNEMDGVVVSAAIERENSEFLGKDAGELAECGKLGVAIT 68

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L  A    DG++DF+ P  T+   + +A+H+IVH+IGTTG +  ++  ++  A +A I
Sbjct: 69  SDLDAAFAEADGVLDFTLPEATVAFADAAARHSIVHVIGTTGMTSAQSTELAHAATSARI 128

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+ AA  L   +D+D E+LEMHH+ K+D+PSGTALLLGEA A G
Sbjct: 129 VKSGNMSLGVNLLAGLVKKAAAAL--DEDFDIEVLEMHHKHKVDAPSGTALLLGEAAAEG 186

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R+++L  H V +R      R  G IG A+LR GS+VGEH+V+ AGEGE I LSH A DR+
Sbjct: 187 REISLETHSVRSRDGITGERNRGDIGFATLRGGSVVGEHTVMFAGEGERIELSHIATDRQ 246

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AA+WA  Q PGLYSM DVLG+
Sbjct: 247 IFARGAVKAAIWAHKQQPGLYSMADVLGL 275


>gi|319403764|emb|CBI77348.1| Dihydrodipicolinate reductase [Bartonella rochalimae ATCC BAA-1498]
          Length = 268

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 172/267 (64%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  G+MG+ LI  +     + L + IVR GSP +G+D    +G + + I+ +D+
Sbjct: 1   MRLAVVGANGKMGRELITALQGRQDVKLSAAIVRKGSPFVGKDASILIGSNSLNIRITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A    + I+DFS PA T+   + +AQ  ++HIIGTTGF+ KE E I++FA +  IVK
Sbjct: 61  FEEAFSKAECILDFSQPAATIIYADYAAQKGLIHIIGTTGFNKKEEEQIAAFAEHTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMS GIN L  LV+ AA+  L A D+D EI EMHH  K+D+PSGTA+LLG+A A GR 
Sbjct: 121 SGNMSFGINLLANLVKKAAK-ALEADDFDIEIYEMHHAEKVDAPSGTAILLGDAAAKGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D  +  R+     R +G+IG    R G+++G+HSV  AG  E I LSH A  R IF
Sbjct: 180 VTLKDVSISERNGYTGKRKKGTIGFICSRGGTVIGDHSVTFAGLNERIVLSHFAQKRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK +  GLYSM DVLG+
Sbjct: 240 AHGALKAALWAKERKNGLYSMLDVLGL 266


>gi|170746564|ref|YP_001752824.1| dihydrodipicolinate reductase [Methylobacterium radiotolerans JCM
           2831]
 gi|170653086|gb|ACB22141.1| Dihydrodipicolinate reductase [Methylobacterium radiotolerans JCM
           2831]
          Length = 265

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 174/265 (65%), Gaps = 3/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V+G  GRMG+ LI+ +      TL + I R GSP +GQD G   G+ P+ +  +D+
Sbjct: 1   MRLVVVGADGRMGRMLIRAVAQAEGCTLSAAIERDGSPALGQDAGVLAGLPPLDVPVTDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  + DG++DF++PA T+    ++AQ  IVH++GTTG S ++   + + + +A IV+
Sbjct: 61  ALTAFAAADGVLDFTAPAATVAFAELAAQARIVHVVGTTGLSEEDFAKLKAASYHARIVQ 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGIN +  LV   A+ L    ++D EI EMHHR K+D+PSGTAL+LGEA A GR 
Sbjct: 121 SGNMSLGINLMAALVRRVAKAL--GDEFDIEIAEMHHRMKVDAPSGTALMLGEAAAEGRG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V+L    V  R     AR  G IG A+LR GS+VG+HSV+ AG GES+T+SH A DR +F
Sbjct: 179 VDLKAVRVSTRDGHTGARRPGDIGFATLRGGSVVGDHSVIFAGTGESLTISHHAADRGLF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A G++ AALWA  + PGLY+M DVL
Sbjct: 239 ATGAVKAALWAHPKPPGLYTMTDVL 263


>gi|319406770|emb|CBI80403.1| Dihydrodipicolinate reductase [Bartonella sp. 1-1C]
          Length = 268

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 125/267 (46%), Positives = 172/267 (64%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  G+MG+ LI  + +   + L + IVR GSP +G+D    +G + + I+ +D+
Sbjct: 1   MRLAVVGANGKMGRELITALQDRQDVKLSAAIVRKGSPFVGKDASILIGSNSLNIRITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A    + I+DFS PA ++   + +AQ  ++HIIGTTGF  KE E I++FA +  IVK
Sbjct: 61  FEEAFSKAECILDFSQPAASIIYADYAAQKGLIHIIGTTGFDKKEEEQIAAFAEHTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+ AA+  L A D+D EI EMHH  K+D+PSGTA+LLG A A GR 
Sbjct: 121 SGNMSLGVNLLANLVKKAAK-ALEADDFDIEIYEMHHAEKVDAPSGTAILLGNAAAKGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D  +  R+     R +G+IG    R G+++G+HSV  AG  E + LSH A  R IF
Sbjct: 180 VTLKDVSISERNGYTGKRKKGTIGFICSRGGTVIGDHSVTFAGLNERVVLSHFAQKRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK +  GLYSM DVLG+
Sbjct: 240 AHGALKAALWAKERKNGLYSMLDVLGL 266


>gi|49474534|ref|YP_032576.1| dihydrodipicolinate reductase [Bartonella quintana str. Toulouse]
 gi|81646888|sp|Q6FZ13|DAPB_BARQU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|49240038|emb|CAF26457.1| hypothetical protein BQ09810 [Bartonella quintana str. Toulouse]
          Length = 270

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 173/267 (64%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  G+MG+ LI  I     + L +++VR GSP + +D     G   + I+ +D+
Sbjct: 1   MRLTVVGANGKMGRELITAIQRREDVELCAVLVRKGSPFVDKDASILTGSDFLNIRITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  + +GI+DFS P  ++   N +AQ ++VHIIGTTGFS  E E I+ FA++  IVK
Sbjct: 61  PENAFSNTEGILDFSQPQASILYANYAAQKSLVHIIGTTGFSKTEEEKIADFAKDTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+ AA+  L   D+D EI EMHH  K+D+PSGTALLLG+A A GR 
Sbjct: 121 SGNMSLGVNLLASLVKKAAK-ALEVDDFDIEIYEMHHSGKVDAPSGTALLLGQAAAEGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R+     R +G+IG A  R G++VG+HS+  AG  E I LSH A DR IF
Sbjct: 180 VMLKNVSVNARNGYTGEREKGTIGFACSRGGTVVGDHSITFAGPNERIVLSHVAQDRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK+   GLYSM DVLG+
Sbjct: 240 ANGALKAALWAKNHENGLYSMLDVLGL 266


>gi|319898434|ref|YP_004158527.1| Dihydrodipicolinate reductase [Bartonella clarridgeiae 73]
 gi|319402398|emb|CBI75939.1| Dihydrodipicolinate reductase [Bartonella clarridgeiae 73]
          Length = 268

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 174/267 (65%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  G+MG+ LI  +     + L + IVR GSP IG+D    +G + + I+ +D+
Sbjct: 1   MRLAVVGANGKMGRELITALQYRQDVKLSAAIVRKGSPFIGKDASILIGSNLLKIRITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A  + + I+DFS P  ++   + +A+  ++HIIGTTGFS KE   I++FA++  IVK
Sbjct: 61  LENAFSNAECILDFSQPQASVVYADYAAKKGLIHIIGTTGFSKKEEMQIAAFAKHTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGIN L  LV+ AA+ +L A D+D EI EMHH  K+D+PSGTALLLG A A GR 
Sbjct: 121 SENMSLGINLLANLVKKAAK-VLEADDFDIEIYEMHHAEKIDAPSGTALLLGNAAAKGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D  +   +     R +G+IG    R G+++G+HSV  AG  E I LSH A +R IF
Sbjct: 180 VTLKDVNISEHNRYTSKRKKGTIGFTCSRGGTVIGDHSVTFAGLNERIVLSHLAQERSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK +  GLYSM DVLG+
Sbjct: 240 ANGALKAALWAKERKNGLYSMLDVLGL 266


>gi|254561648|ref|YP_003068743.1| dihydrodipicolinate reductase [Methylobacterium extorquens DM4]
 gi|254268926|emb|CAX24887.1| dihydrodipicolinate reductase [Methylobacterium extorquens DM4]
          Length = 267

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 172/267 (64%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ V+G  GRMG+ LI+ +      TLH  + R GS ++GQD G   GI  +G+  SD+
Sbjct: 1   MKLVVVGAEGRMGRMLIRAVAEAEGCTLHGAVERPGSAVLGQDAGLLAGIGELGVPVSDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                 + DG++DF++PA T+    ++AQ  IVH++GTTG S  +   + + + +A +V+
Sbjct: 61  PLSRFVAADGVLDFTAPAATVAFAELAAQARIVHVVGTTGLSEDDLTRLKAASYHARVVR 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV   A  L   +++D E+LEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLAGLVRKVAATL--GQEFDIEVLEMHHRMKVDAPSGTALLLGEAAAEGRN 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R     AR  G IG A+LR GS+VG+HSV+ AG  E ITLSH A DR IF
Sbjct: 179 VALAETRVSTRDGHTGARRPGDIGFATLRGGSVVGDHSVIFAGPSERITLSHHAEDRAIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AA WA  + PGLY M DVLG+
Sbjct: 239 ARGAVRAAQWAFDKPPGLYGMDDVLGL 265


>gi|163851930|ref|YP_001639973.1| dihydrodipicolinate reductase [Methylobacterium extorquens PA1]
 gi|218530681|ref|YP_002421497.1| dihydrodipicolinate reductase [Methylobacterium chloromethanicum
           CM4]
 gi|163663535|gb|ABY30902.1| Dihydrodipicolinate reductase [Methylobacterium extorquens PA1]
 gi|218522984|gb|ACK83569.1| Dihydrodipicolinate reductase [Methylobacterium chloromethanicum
           CM4]
          Length = 267

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 172/267 (64%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ V+G  GRMG+ LI+ +      TLH  + R GS ++GQD G   GI  +G+  SD+
Sbjct: 1   MKLVVVGAEGRMGRMLIRAVAEAEGCTLHGAVERPGSAVLGQDAGLLAGIGELGVPVSDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                 + DG++DF++PA T+    ++AQ  IVH++GTTG S  +   + + + +A +V+
Sbjct: 61  PLSLFVAADGVLDFTAPAATVAFAELAAQARIVHVVGTTGLSEDDLTRLKAASYHARVVR 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV   A  L   +++D E+LEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLAGLVRKVAATL--GQEFDIEVLEMHHRMKVDAPSGTALLLGEAAAEGRN 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R     AR  G IG A+LR GS+VG+HSV+ AG  E ITLSH A DR IF
Sbjct: 179 VALAETRVSTRDGHTGARRPGDIGFATLRGGSVVGDHSVIFAGPSERITLSHHAEDRAIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AA WA  + PGLY M DVLG+
Sbjct: 239 ARGAVRAAQWAFDKPPGLYGMDDVLGL 265


>gi|299133270|ref|ZP_07026465.1| dihydrodipicolinate reductase [Afipia sp. 1NLS2]
 gi|298593407|gb|EFI53607.1| dihydrodipicolinate reductase [Afipia sp. 1NLS2]
          Length = 270

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 173/270 (64%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+ L++ +H     T+   +    S L+G+D G   G++P GI  S
Sbjct: 2   SDMRLIVAGAGGRMGRTLLRALHETEGATVVGALEAPDSELLGEDSGVLAGLAPNGIPLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L    +  DGI+DF+ PA T+ ++ I+A+  +VH+IGTTG S  +N VI S    A +
Sbjct: 62  ADLWTLSKDADGILDFTVPAATIANVAIAAERGLVHVIGTTGLSASDNAVIKSVTSRAIV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  LV+  A+ L    D+D EILEMHHR K+D+PSGTA LLG+A A G
Sbjct: 122 VQSGNMSLGVNLLAALVKQVAKSL--DDDFDIEILEMHHRAKIDAPSGTAYLLGQAAAEG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L    V +R     AR  G IG A+LR G++ GEH+V+ +G  E I L+H A DR 
Sbjct: 180 RGIALEGKSVRSRDGYTGARNRGDIGFATLRGGTVTGEHTVIFSGPYERIELTHRAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IFARG++ AA WA+ + PG YSM DVLGIG
Sbjct: 240 IFARGAIKAACWARGRKPGHYSMADVLGIG 269


>gi|85714053|ref|ZP_01045042.1| dihydrodipicolinate reductase [Nitrobacter sp. Nb-311A]
 gi|85699179|gb|EAQ37047.1| dihydrodipicolinate reductase [Nitrobacter sp. Nb-311A]
          Length = 267

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 172/269 (63%), Gaps = 3/269 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V G GGRMG+AL++ I    +  L   +   GS LIG+D G   G+   GI  S +
Sbjct: 1   MRLIVAGAGGRMGRALVRAIAETENAVLAGALEAPGSELIGKDAGILAGLPASGIGVSAD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L     + DGI+DF+ PA T+ ++ I+A+  +VH+IGTTG S  +  VI S      +V+
Sbjct: 61  LWSLSANADGILDFTVPAATIANVAIAAERGLVHVIGTTGLSASDMAVIRSVTSRTVVVQ 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+  A+ L   + +D EILEMHHR K+D+PSGTAL+LG+A A GRK
Sbjct: 121 SGNMSLGVNLLAALVKRMAQSL--DESFDIEILEMHHRAKIDAPSGTALMLGQAAAEGRK 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L    V  R     AR  G IG ASLR GS+ G+HSV+ AG  E ITLSH A DR IF
Sbjct: 179 VRLDQRAVRGRDGLTGARRAGDIGFASLRGGSVSGDHSVIFAGPYERITLSHHAEDRMIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGIGL 273
           A G+L AA WA+ + PGLYSM DVLG+G+
Sbjct: 239 AHGALKAATWARGKPPGLYSMADVLGLGV 267


>gi|240139054|ref|YP_002963529.1| dihydrodipicolinate reductase [Methylobacterium extorquens AM1]
 gi|240009026|gb|ACS40252.1| dihydrodipicolinate reductase [Methylobacterium extorquens AM1]
          Length = 267

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 172/267 (64%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ V+G  GRMG+ LI+ +      TLH  + R GS ++GQD G   GI  +G+  SD+
Sbjct: 1   MKLVVVGAEGRMGRMLIRAVAEAEGCTLHGAVERPGSAVLGQDAGLLAGIGELGVPVSDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                 + DG++DF++PA T+    ++AQ  IVH++GTTG S  +   + + + +A +V+
Sbjct: 61  PLSRFVAADGVLDFTAPAATVAFAELAAQARIVHVVGTTGLSEDDLTRLKAASYHARVVR 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV   A  L   +++D E+LEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLAGLVRKVAATL--GQEFDIEVLEMHHRMKVDAPSGTALLLGEAAAVGRN 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R     AR  G IG A+LR GS+VG+HSV+ AG  E ITLSH A DR IF
Sbjct: 179 VALAETRVSTRDGHTGARRPGDIGFATLRGGSVVGDHSVIFAGPSERITLSHHAEDRAIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AA WA  + PGLY M DVLG+
Sbjct: 239 ARGAVRAAQWAFDKPPGLYGMDDVLGL 265


>gi|114705032|ref|ZP_01437940.1| dihydrodipicolinate reductase [Fulvimarina pelagi HTCC2506]
 gi|114539817|gb|EAU42937.1| dihydrodipicolinate reductase [Fulvimarina pelagi HTCC2506]
          Length = 271

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 170/266 (63%), Gaps = 2/266 (0%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V G  GRMG+ +I+ +       L S +  + S  +G+D G+  G+   G+    ++
Sbjct: 5   RIAVFGAAGRMGRTIIRIVSEADGAVLVSALESASSLSLGEDAGSHAGLKRAGVTIGSDI 64

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A A+   D +IDFS+P  +      +A+    H+IGTTGF+    + I+  A    IVKS
Sbjct: 65  ASALSRADAVIDFSAPTASAMLSEAAAKAGCAHVIGTTGFTADHEDRIAKSATETAIVKS 124

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMSLG+N L  LVE AA  L PA  +D E+LEMHH+ K+D+PSGTALLLGEA A GR++
Sbjct: 125 GNMSLGVNLLAGLVEQAARAL-PANLFDIEVLEMHHKHKVDAPSGTALLLGEAAAKGREI 183

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
            L  + V  R  Q   R  G+IG A+LR GS+VGEHSV+ AGEGE I LSH A DR IFA
Sbjct: 184 ELAGNSVRVRDGQTGPRETGTIGFATLRGGSVVGEHSVIFAGEGERIELSHQAGDREIFA 243

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG++ AA+W K + PGLYSMRDVLG+
Sbjct: 244 RGAVAAAIWTKGRAPGLYSMRDVLGL 269


>gi|304393005|ref|ZP_07374934.1| dihydrodipicolinate reductase [Ahrensia sp. R2A130]
 gi|303294770|gb|EFL89141.1| dihydrodipicolinate reductase [Ahrensia sp. R2A130]
          Length = 274

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 175/275 (63%), Gaps = 2/275 (0%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M   PM+I V+G  GRMGQ L++ +     + L     R GS  IG+D G   G+   G+
Sbjct: 1   MSSQPMKIVVVGAAGRMGQTLVRAVAETDGVILSGATEREGSDAIGKDAGEIAGLGANGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+   A    DG++DF+ PA +++   ++AQ  IVH+IGTTG +  +     + AR+
Sbjct: 61  IISDDPLPAFVEADGVLDFTIPAASVEFSTLAAQARIVHVIGTTGCTDDDEAKFLAAARH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
           A IVKS NMSLG+N L  LV  AA+ L  A D+D E+LEMHHR K+D+PSGTALLLGEA 
Sbjct: 121 ARIVKSGNMSLGVNLLAVLVRQAAKALA-AADFDIEVLEMHHRHKVDAPSGTALLLGEAA 179

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR + L ++    R     AR  G IG A+LR GS++GEHSV+ AGEGE+I L+H A 
Sbjct: 180 AEGRDIVLAENSTRVRDGITGARPAGEIGFATLRGGSVIGEHSVLYAGEGETIELTHRAT 239

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLD 274
           DR +FARG++ AALWA  + PG Y M DVLG+  D
Sbjct: 240 DRLLFARGAVKAALWAWDKNPGRYDMLDVLGLSKD 274


>gi|255918072|pdb|3IJP|A Chain A, Crystal Structure Of Dihydrodipicolinate Reductase From
           Bartonella Henselae At 2.0a Resolution
 gi|255918073|pdb|3IJP|B Chain B, Crystal Structure Of Dihydrodipicolinate Reductase From
           Bartonella Henselae At 2.0a Resolution
          Length = 288

 Score =  241 bits (615), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 174/272 (63%), Gaps = 5/272 (1%)

Query: 3   QSP--MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           Q P  MR++V+G  GRMG+ LI  I     + L +++VR GS  + +D    +G   +G+
Sbjct: 17  QGPGSMRLTVVGANGRMGRELITAIQRRKDVELCAVLVRKGSSFVDKDASILIGSDFLGV 76

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           + +D+   A  + +GI+DFS P  ++   N +AQ +++HIIGTTGFS  E   I+ FA+ 
Sbjct: 77  RITDDPESAFSNTEGILDFSQPQASVLYANYAAQKSLIHIIGTTGFSKTEEAQIADFAKY 136

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IVKS NMSLG+N L  LV+ AA+ L    D+D EI EMHH  K+DSPSGTALLLG+A 
Sbjct: 137 TTIVKSGNMSLGVNLLANLVKRAAKAL--DDDFDIEIYEMHHANKVDSPSGTALLLGQAA 194

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A GR + L +  V  R      R +G+IG A  R G+++G+HS+  AGE E I LSH A 
Sbjct: 195 AEGRNIMLKNVSVNGRSGHTGKREKGTIGFACSRGGTVIGDHSITFAGENERIVLSHIAQ 254

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R IFA G+L AALWAK+   GLYSM DVLG+
Sbjct: 255 ERSIFANGALKAALWAKNHENGLYSMLDVLGL 286


>gi|260463452|ref|ZP_05811652.1| dihydrodipicolinate reductase [Mesorhizobium opportunistum WSM2075]
 gi|259030777|gb|EEW32053.1| dihydrodipicolinate reductase [Mesorhizobium opportunistum WSM2075]
          Length = 287

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/269 (52%), Positives = 183/269 (68%), Gaps = 2/269 (0%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M + V+G  GRMGQ LI+ IH  P   +   + R+ SP +G+D G   GI  + +  S
Sbjct: 19  SDMGLVVVGAAGRMGQTLIRAIHTIPGARVIGAVERADSPHLGKDAGELAGIGIINVPIS 78

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+   A    DG++DF++ A T++    +AQ  IVH+IGTTG S ++N  I++ AR+A I
Sbjct: 79  DDPLPAFAKADGVLDFTTSASTVEFAGYAAQARIVHVIGTTGCSAQDNAKIAAAARHATI 138

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LVE AA  L  A D+D EILEMHHR K+D+PSGTALLLGEA A G
Sbjct: 139 VKSGNMSLGVNLLAVLVEQAARAL-DADDFDIEILEMHHRHKVDAPSGTALLLGEAAAAG 197

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L  + V +R      R  GSIG A+LR GS+VG+HSV++AG GE ITLSH A DR 
Sbjct: 198 RDIALAGNDVRSRDGHTGVRKTGSIGFATLRGGSVVGDHSVILAGTGERITLSHHAEDRA 257

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFARG++ AALWA+ + PGLYSMRDVLG+
Sbjct: 258 IFARGAVKAALWARGKKPGLYSMRDVLGL 286


>gi|49475957|ref|YP_033998.1| dihydrodipicolinate reductase [Bartonella henselae str. Houston-1]
 gi|81647686|sp|Q6G2G3|DAPB_BARHE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|49238765|emb|CAF28026.1| Dihydrodipicolinate reductase [Bartonella henselae str. Houston-1]
          Length = 267

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 172/267 (64%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  GRMG+ LI  I     + L +++VR GS  + +D    +G   +G++ +D+
Sbjct: 1   MRLTVVGANGRMGRELITAIQRRKDVELCAVLVRKGSSFVDKDASILIGSDFLGVRITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  + +GI+DFS P  ++   N +AQ +++HIIGTTGFS  E   I+ FA+   IVK
Sbjct: 61  PESAFSNTEGILDFSQPQASVLYANYAAQKSLIHIIGTTGFSKTEEAQIADFAKYTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+ AA+ L    D+D EI EMHH  K+DSPSGTALLLG+A A GR 
Sbjct: 121 SGNMSLGVNLLANLVKRAAKAL--DDDFDIEIYEMHHANKVDSPSGTALLLGQAAAEGRN 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L +  V  R      R +G+IG A  R G+++G+HS+  AGE E I LSH A +R IF
Sbjct: 179 IMLKNVSVNGRSGHTGKREKGTIGFACSRGGTVIGDHSITFAGENERIVLSHIAQERSIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK+   GLYSM DVLG+
Sbjct: 239 ANGALKAALWAKNHENGLYSMLDVLGL 265


>gi|92115790|ref|YP_575519.1| dihydrodipicolinate reductase [Nitrobacter hamburgensis X14]
 gi|91798684|gb|ABE61059.1| dihydrodipicolinate reductase [Nitrobacter hamburgensis X14]
          Length = 289

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 171/268 (63%), Gaps = 3/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V G GGRMG+AL++ I  +    L   +   GS LIG+D G   G+   GI+ S +
Sbjct: 22  MRLIVAGAGGRMGRALVRAIAESGGAVLAGALEPPGSELIGKDTGVLAGLPANGIEVSAD 81

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       DGI+DF+ PA T+ ++ I+A+  +VH+IGTTG S  +  VI S      +V+
Sbjct: 82  LWSLSAHADGILDFTVPAATIANVAIAAERGLVHVIGTTGLSASDMAVIKSVTSRTVVVQ 141

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGIN L  LV+  A+ L   + +D EILEMHHR K+D+PSGTAL+LG+A A+GRK
Sbjct: 142 SGNMSLGINLLAALVKRMAQSL--DESFDIEILEMHHRAKIDAPSGTALMLGQAAADGRK 199

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L  H    R     AR  G IG ASLR G++ G+HSV+ AG  E ITLSH A DR IF
Sbjct: 200 IVLDQHAARGRDGITGARKSGDIGFASLRGGTVSGDHSVIFAGPYERITLSHHAEDRMIF 259

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           A G+L AA WA  + PGLYSM DVLG+G
Sbjct: 260 AHGALKAAKWAHGKTPGLYSMADVLGLG 287


>gi|319405202|emb|CBI78807.1| Dihydrodipicolinate reductase [Bartonella sp. AR 15-3]
          Length = 268

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 125/267 (46%), Positives = 172/267 (64%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++++G  G+MG+ LI  +     + L + IVR GSP +G+D    +G +P+ I  +D+
Sbjct: 1   MRLAIVGANGKMGRELITALQYRQDVKLSAAIVRKGSPFVGKDASILIGSNPLKICITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A  + + I+DFS P  ++   + +AQ  ++HIIGTTGFS KE   I++FA++  IVK
Sbjct: 61  FEDAFSNAECILDFSQPQASIIYADYAAQKGLIHIIGTTGFSKKEERQIAAFAKHTTIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGIN L  LV+ AA+  L A D+D EI EMHH  K+D+PSGTA+LLG A A GR 
Sbjct: 121 SGNMSLGINLLANLVKKAAK-ALEADDFDIEIYEMHHAGKVDAPSGTAILLGNAAAKGRN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L D  +  R+     R +G+IG    R G+++G+HSV  AG  E I LSH A  R IF
Sbjct: 180 MILKDINISKRNGHTGKRKKGTIGFICSRGGTVIGDHSVTFAGLNERIVLSHLAQKRSIF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALWAK +  GLYSM DVLG+
Sbjct: 240 ANGALKAALWAKERKNGLYSMLDVLGL 266


>gi|296448179|ref|ZP_06890077.1| dihydrodipicolinate reductase [Methylosinus trichosporium OB3b]
 gi|296254310|gb|EFH01439.1| dihydrodipicolinate reductase [Methylosinus trichosporium OB3b]
          Length = 272

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 129/270 (47%), Positives = 173/270 (64%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G  GRMG+ LI  I ++  +TL   +  SGSP IG+D G  +G    G+  S
Sbjct: 2   SEMRLVVAGAAGRMGRMLIAAIGDSLGVTLTGALEYSGSPHIGEDAGLLIGRPANGVALS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +    +   D +IDFSSPA T+     +AQ  + H+IGTTG +  +   I++ A    +
Sbjct: 62  ADAGAVLSQADALIDFSSPAATVALAAQTAQAGVAHVIGTTGLTGGDLAAIAAAAERNVV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  LVE AA+ L PA  WD EI+EMHH+ K+D+PSGTALLLGEA+A+G
Sbjct: 122 VRSGNMSLGVNLLAVLVERAAKALGPA--WDAEIVEMHHKMKVDAPSGTALLLGEAVAHG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V+L++     R      R  G IG A+LR G++VG+H V+ AG GE I L+H A DR 
Sbjct: 180 RGVDLSERSARARDGVTGPRQAGDIGFAALRGGTVVGDHMVIFAGAGERIELAHRAEDRG 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IFARG++ AALW + +  GLYSM DVLG+G
Sbjct: 240 IFARGAVAAALWTRGRAAGLYSMADVLGLG 269


>gi|170740308|ref|YP_001768963.1| dihydrodipicolinate reductase [Methylobacterium sp. 4-46]
 gi|168194582|gb|ACA16529.1| Dihydrodipicolinate reductase [Methylobacterium sp. 4-46]
          Length = 265

 Score =  238 bits (606), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 174/267 (65%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V+G  GRMG+ LI+ + +    TL   + R G+  +G D G   G+ P+G+  +D+
Sbjct: 1   MRLVVVGASGRMGRMLIQAVTSTEGCTLAGAVEREGAEAVGTDAGLLAGLPPLGLAVTDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A    DG++DF++PA T+    ++AQ  +VH++GTTG S  +   + + +R+A IV+
Sbjct: 61  PLRAFAEADGVLDFTAPAATVFYAELAAQARLVHVVGTTGLSPDDLRRLEAASRHARIVR 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV   A  L   +D+D EILEMHHR K+D+PSGTALLLGEA A GR 
Sbjct: 121 SGNMSLGVNLLAGLVRKVAAAL--GEDFDIEILEMHHRHKVDAPSGTALLLGEAAAQGRA 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L +  V  R  Q   R  G+IG A+LR GS+VGEHSV+ AG GE I L+H A DR +F
Sbjct: 179 VALAERKVAVRDGQTGPRVPGTIGFATLRGGSVVGEHSVIFAGAGERIELTHRAEDRGLF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA  Q PGLY M DVLG+
Sbjct: 239 ARGAIRAALWAAPQKPGLYDMDDVLGL 265


>gi|254502995|ref|ZP_05115146.1| dihydrodipicolinate reductase [Labrenzia alexandrii DFL-11]
 gi|222439066|gb|EEE45745.1| dihydrodipicolinate reductase [Labrenzia alexandrii DFL-11]
          Length = 265

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 123/264 (46%), Positives = 171/264 (64%), Gaps = 2/264 (0%)

Query: 8   ISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAM 67
           + V  GGRMG+AL + + +     + + I + GSP +GQD G   G+  + +  +D+   
Sbjct: 2   VVVGAGGRMGRALTRAVTDAAGADVAAAIEQEGSPFLGQDAGELAGVGALNVPVTDDPLS 61

Query: 68  AIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSN 127
           A    DG++DF++P  ++    ++AQ  IVH+IGTTG++ +E   + + AR+A I+KS N
Sbjct: 62  AFAKADGVLDFTAPKASIWFAELAAQARIVHVIGTTGWTPEEETPLRAAARHARIIKSGN 121

Query: 128 MSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNL 187
           MSLG+N L  LV  AA  L    D   E+LEMHH+ K+D+PSGTALLLGEA A GR ++L
Sbjct: 122 MSLGVNLLASLVRKAAAALDADFD--IEVLEMHHKHKVDAPSGTALLLGEAAAEGRGIDL 179

Query: 188 TDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARG 247
             H V +R      R  G IG A+LR GS++GEHSV+ AGEGE I L+H A DR++FARG
Sbjct: 180 QTHSVRSRDGIMDPRKTGDIGFATLRGGSVIGEHSVIFAGEGERIELTHRAEDRQLFARG 239

Query: 248 SLTAALWAKSQIPGLYSMRDVLGI 271
           ++ AALW   Q PG YSM DVLG+
Sbjct: 240 AVKAALWGFDQKPGFYSMADVLGL 263


>gi|148251815|ref|YP_001236400.1| dihydrodipicolinate reductase [Bradyrhizobium sp. BTAi1]
 gi|166222615|sp|A5E8K0|DAPB_BRASB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|146403988|gb|ABQ32494.1| dihydrodipicolinate reductase [Bradyrhizobium sp. BTAi1]
          Length = 272

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/269 (47%), Positives = 167/269 (62%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL++ I ++    L   +   GS LIG+D G   G+   GIK S
Sbjct: 2   SKMRLIVAGAGGRMGRALVRAIADSDGAELAGALEAPGSELIGKDAGVLAGLPANGIKLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L       DGI+DF+ PA T+ ++ I+A+  I HIIGTTG S  ++ VI S  + A +
Sbjct: 62  GDLWTMSAEADGILDFTVPAATIANVAIAAERGIAHIIGTTGLSASDDAVIKSVTKRAIV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  LV+  A+ L     +D EILEMHH+ K+D+PSGTAL+LG A A G
Sbjct: 122 VQSGNMSLGVNLLSALVKQVAKSLDAG--FDIEILEMHHKHKVDAPSGTALMLGRAAAEG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V L  H    R      R  G IG ASLR G+  G+HSV+ AG  E + LSH A DR 
Sbjct: 180 RGVVLDQHSARGRDGITGERRSGDIGFASLRGGTAAGDHSVIFAGPSERLVLSHQAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFA G+L AALWA  + PG Y+M DVLG+
Sbjct: 240 IFAHGALKAALWAHGKPPGYYTMSDVLGL 268


>gi|146337327|ref|YP_001202375.1| dihydrodipicolinate reductase [Bradyrhizobium sp. ORS278]
 gi|166222616|sp|A4YJP9|DAPB_BRASO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|146190133|emb|CAL74125.1| Dihydrodipicolinate reductase (DHPR) [Bradyrhizobium sp. ORS278]
          Length = 272

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 169/269 (62%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL++ I ++    L   +   GS LIG+D G   G+    IK S
Sbjct: 2   SRMRLIVAGAGGRMGRALVRAIADSDGAELAGALEAPGSELIGKDSGLLAGLPANNIKLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L       DGI+DF+ PA T+ ++ I+A+  IVH++GTTG S  ++ VI S  + A +
Sbjct: 62  ADLWAMSAEADGILDFTVPAATIANVAIAAERGIVHVVGTTGLSASDDAVIKSVTKRAIV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  LV+  A+ L    ++D EILEMHH+ K+D+PSGTAL+LG A A G
Sbjct: 122 VQSGNMSLGVNLLSALVKQVAKSL--DANFDIEILEMHHKHKVDAPSGTALMLGRAAAEG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R + L  H    R     AR  G IG ASLR G+  G+HSV+ AG  E + LSH A DR 
Sbjct: 180 RGITLDGHSARGRDGITGARRSGDIGFASLRGGTAAGDHSVIFAGPSERLVLSHQAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFA G+L AALWA  + PG Y+M DVLG+
Sbjct: 240 IFAHGALKAALWAHGKPPGYYTMDDVLGL 268


>gi|154244316|ref|YP_001415274.1| dihydrodipicolinate reductase [Xanthobacter autotrophicus Py2]
 gi|154158401|gb|ABS65617.1| Dihydrodipicolinate reductase [Xanthobacter autotrophicus Py2]
          Length = 300

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 169/270 (62%), Gaps = 3/270 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +RI + G GGRMG+ALIK I     + L   +  SGS  +G+D G   G+ P G+   
Sbjct: 31  SQLRIVISGAGGRMGRALIKAISETEGLALVGALEYSGSSFLGEDAGAMSGLKPNGVTVE 90

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            + A  +   D ++DFS+P+ +++     A   I H+IGTTGFS ++N  I++ AR  PI
Sbjct: 91  SDAAPTLNGADVVVDFSTPSASVRLAETLAGAGIAHVIGTTGFSNEDNAAIAAAARRTPI 150

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           +KS NMSLG+N L  L    A  L     +D EI+EMHH +K+D+PSGTALLLGEA A G
Sbjct: 151 MKSGNMSLGVNLLAALTRRVAATL--DDSFDIEIVEMHHNKKVDAPSGTALLLGEAAAQG 208

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R  +L +     R     AR  G+IG ASLR GS+VGEH V+ AG+ E I L H A DR 
Sbjct: 209 RGRHLDECSERGRDGVTGARKPGAIGFASLRGGSVVGEHMVIFAGQAERIELVHKAEDRM 268

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           IFARG+LTAA W K + PGLYSM DVLG+G
Sbjct: 269 IFARGALTAARWLKGREPGLYSMADVLGLG 298


>gi|90421859|ref|YP_530229.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris BisB18]
 gi|122477596|sp|Q21CH6|DAPB_RHOPB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|90103873|gb|ABD85910.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris BisB18]
          Length = 271

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 172/269 (63%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+ALI+ I   P   +   +    S L+GQD G   G+ P G+K S
Sbjct: 2   SDMRLIVAGAGGRMGRALIRAITETPGAVVAGALEAPTSALLGQDAGTLAGLPPSGVKLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L       DGI+DF+ P  T+ ++ I+AQ  +VH+IGTTG +  ++ VISS    A +
Sbjct: 62  ADLWALSAEADGIVDFTVPEATIANVAIAAQRGMVHVIGTTGLTASDDAVISSVTSRATV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  LV+  A  L     +D EI+EMHH+ K+D+PSGTALLLGEA A G
Sbjct: 122 VKSGNMSLGVNLLAALVKRVARSL--DDGFDIEIVEMHHKAKIDAPSGTALLLGEAAAAG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V L +H +  R     AR  G IG ASLR G++ G+H+V+ AG  E I L+H A DR 
Sbjct: 180 RGVALAEHSIRGRDGVTGARKAGDIGFASLRGGTVTGDHTVIFAGPYERIELTHKAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFA G+L AALWA+ Q PGLYSM DVLG+
Sbjct: 240 IFAHGALKAALWARDQGPGLYSMADVLGL 268


>gi|319780495|ref|YP_004139971.1| dihydrodipicolinate reductase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166383|gb|ADV09921.1| dihydrodipicolinate reductase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 280

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 181/267 (67%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M + V+G  GRMGQ LI+ IH+     +   + R+ SP +G+D G   GI  + +  SD+
Sbjct: 14  MGLVVVGAAGRMGQTLIRAIHSISGARVIGAVERADSPHLGKDAGELAGIGIINVPISDD 73

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                   DG++DF++PA T++    +AQ  IVH+IGTTG S  +N  I++ AR+A IVK
Sbjct: 74  PLPVFAKADGVLDFTTPASTVEFAGYAAQARIVHVIGTTGCSTDDNARIAAAARHATIVK 133

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LVE AA  L  A D+D EILEMHH+ K+D+PSGTALLLGEA A GR 
Sbjct: 134 SGNMSLGVNLLAVLVEQAARAL-DADDFDIEILEMHHKHKVDAPSGTALLLGEAAAAGRG 192

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           + L+ + V  R      R  GSIG A+LR GS+VG+HSV++AG GE ITLSH A DR IF
Sbjct: 193 IELSGNDVRVRDGHTGVRKTGSIGFATLRGGSVVGDHSVMLAGTGERITLSHHAEDRAIF 252

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA+ + PGLYSMRDVLG+
Sbjct: 253 ARGAVKAALWARGKKPGLYSMRDVLGL 279


>gi|90101246|sp|Q3SW72|DAPB_NITWN RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
          Length = 267

 Score =  232 bits (591), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 167/267 (62%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V G GGRMG+AL++ I       L   +    S LIG+D     G+   GI+ S +
Sbjct: 1   MRLIVAGAGGRMGRALVRAIAETDGAVLAGALEAPESELIGKDASVLAGLPASGIEVSAD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       DGI+DF+ PA T+ ++ ++A+  ++H+IGTTG S  +  VI S      +V+
Sbjct: 61  LWSLSAKADGILDFTVPAATIANVAVAAERGLIHVIGTTGLSASDMAVIRSVTSRTAVVQ 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+  A+ L   + +D E+LEMHHR K+D+PSGTAL+LG+A A+GRK
Sbjct: 121 SGNMSLGVNLLAALVKRMAQAL--DESFDVEVLEMHHRAKIDAPSGTALMLGQAAADGRK 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L    V  R     AR  G IG ASLR G++ G+HSV+ AG  E ITLSH A DR IF
Sbjct: 179 VGLDQRAVRGRDGLTGARKAGDIGFASLRGGTVSGDHSVIFAGPYERITLSHHAEDRMIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AA WA  + PGLYSM DVLG+
Sbjct: 239 AHGALKAAKWAFGKEPGLYSMSDVLGL 265


>gi|75674400|ref|YP_316821.1| dihydrodipicolinate reductase [Nitrobacter winogradskyi Nb-255]
 gi|74419270|gb|ABA03469.1| dihydrodipicolinate reductase [Nitrobacter winogradskyi Nb-255]
          Length = 288

 Score =  232 bits (591), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 167/267 (62%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR+ V G GGRMG+AL++ I       L   +    S LIG+D     G+   GI+ S +
Sbjct: 22  MRLIVAGAGGRMGRALVRAIAETDGAVLAGALEAPESELIGKDASVLAGLPASGIEVSAD 81

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       DGI+DF+ PA T+ ++ ++A+  ++H+IGTTG S  +  VI S      +V+
Sbjct: 82  LWSLSAKADGILDFTVPAATIANVAVAAERGLIHVIGTTGLSASDMAVIRSVTSRTAVVQ 141

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LV+  A+ L   + +D E+LEMHHR K+D+PSGTAL+LG+A A+GRK
Sbjct: 142 SGNMSLGVNLLAALVKRMAQAL--DESFDVEVLEMHHRAKIDAPSGTALMLGQAAADGRK 199

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L    V  R     AR  G IG ASLR G++ G+HSV+ AG  E ITLSH A DR IF
Sbjct: 200 VGLDQRAVRGRDGLTGARKAGDIGFASLRGGTVSGDHSVIFAGPYERITLSHHAEDRMIF 259

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AA WA  + PGLYSM DVLG+
Sbjct: 260 AHGALKAAKWAFGKEPGLYSMSDVLGL 286


>gi|91974865|ref|YP_567524.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris BisB5]
 gi|123722204|sp|Q13E66|DAPB_RHOPS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|91681321|gb|ABE37623.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris BisB5]
          Length = 271

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 136/269 (50%), Positives = 169/269 (62%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL + I     + L   +   GS L+GQD G   G+   G+K S
Sbjct: 2   SDMRLIVAGAGGRMGRALTRAISETKGVVLTGALEAPGSELLGQDAGVLAGLPANGVKLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L       DGI+DF+ PA T+ ++ I+AQ  IVH+IGTTG S  +N VI S    A +
Sbjct: 62  ADLWTLSAGADGILDFTVPAATIANVAIAAQRGIVHVIGTTGLSSSDNAVIKSVTDQAIV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  L    A+ L     +D EI+EMHHR K+D+PSGTALLLGEA A G
Sbjct: 122 VKSGNMSLGVNLLAALTRRVAQSLDAG--FDIEIVEMHHRAKIDAPSGTALLLGEAAAAG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           RKV+L DH    R     AR  G IG ASLR G++ G+HSV+ AG  E I L+H A DR 
Sbjct: 180 RKVDLDDHSARGRDGVTGARKTGDIGFASLRGGTVTGDHSVIFAGPYERIELAHKAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFA G+L AA WA  + PGLYSM DVLG+
Sbjct: 240 IFAHGALKAAQWAHGKSPGLYSMMDVLGL 268


>gi|27375796|ref|NP_767325.1| dihydrodipicolinate reductase [Bradyrhizobium japonicum USDA 110]
 gi|27348934|dbj|BAC45950.1| dihydrodipicolinate reductase [Bradyrhizobium japonicum USDA 110]
          Length = 295

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 170/269 (63%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL + I  +    L   +   GS ++G+D G   G+   GIK S
Sbjct: 26  SDMRLIVAGAGGRMGRALTRAIAESKGAVLAGALEAPGSEMLGKDAGVLAGLPANGIKLS 85

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L    +  DGI+DF+ PA T+ ++ I+A+  IVH+IGTTG S  +N VI S    A +
Sbjct: 86  ADLWAMSKEADGILDFTVPAATIANVAIAAERGIVHVIGTTGLSGSDNAVIKSVTNRAVV 145

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  +V+  A+ L   + +D EI+E HHR K+D+PSGTAL+LG+A A G
Sbjct: 146 VQSGNMSLGVNLLAAVVKRVAKAL--DQSFDIEIVETHHRMKIDAPSGTALMLGQAAAAG 203

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R ++L +H    R     AR  G+IG ASLR G+  G+HSV   G  E +TLSH A DR 
Sbjct: 204 RGISLDEHADRGRDGITGARKPGNIGFASLRGGTAAGDHSVSFLGPFERLTLSHQAEDRM 263

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FA G+L AALWA  + PG YSM DVLG+
Sbjct: 264 LFAHGALKAALWAHGKKPGHYSMADVLGL 292


>gi|39931123|sp|Q89WK2|DAPB_BRAJA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
          Length = 271

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 170/269 (63%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL + I  +    L   +   GS ++G+D G   G+   GIK S
Sbjct: 2   SDMRLIVAGAGGRMGRALTRAIAESKGAVLAGALEAPGSEMLGKDAGVLAGLPANGIKLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L    +  DGI+DF+ PA T+ ++ I+A+  IVH+IGTTG S  +N VI S    A +
Sbjct: 62  ADLWAMSKEADGILDFTVPAATIANVAIAAERGIVHVIGTTGLSGSDNAVIKSVTNRAVV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  +V+  A+ L   + +D EI+E HHR K+D+PSGTAL+LG+A A G
Sbjct: 122 VQSGNMSLGVNLLAAVVKRVAKAL--DQSFDIEIVETHHRMKIDAPSGTALMLGQAAAAG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R ++L +H    R     AR  G+IG ASLR G+  G+HSV   G  E +TLSH A DR 
Sbjct: 180 RGISLDEHADRGRDGITGARKPGNIGFASLRGGTAAGDHSVSFLGPFERLTLSHQAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FA G+L AALWA  + PG YSM DVLG+
Sbjct: 240 LFAHGALKAALWAHGKKPGHYSMADVLGL 268


>gi|13473896|ref|NP_105464.1| dihydrodipicolinate reductase [Mesorhizobium loti MAFF303099]
 gi|14547952|sp|P58210|DAPB1_RHILO RecName: Full=Dihydrodipicolinate reductase 1; Short=DHPR 1
 gi|14024647|dbj|BAB51250.1| dihydrodipicolinate reductase [Mesorhizobium loti MAFF303099]
          Length = 273

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 175/258 (67%), Gaps = 1/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+ IH  P   +   + R+ SP +G+D G   GI  + +   D+        D
Sbjct: 16  GRMGQTLIRAIHTIPGARVIGAVERADSPHLGKDAGELAGIGIINVPIGDDPLPVFAKAD 75

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
           G++DF++PA +++    +AQ  IVH+IGTTG S  +N  I++ AR+A IVKS NMSLG+N
Sbjct: 76  GVLDFTTPASSVEFAGYAAQARIVHVIGTTGCSADDNARIAAAARHATIVKSGNMSLGVN 135

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LVE AA  L  A D+D EILEMHH+ K+D+PSGTALLLGEA A GR + L  + V 
Sbjct: 136 LLAVLVEQAARAL-DADDFDIEILEMHHKHKVDAPSGTALLLGEAAAAGRGIALAGNDVR 194

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
           +R      R  GSIG A+LR GS+VG+HSV++AG GE ITLSH A DR IFARG++ AAL
Sbjct: 195 SRDGHTGVRKTGSIGFATLRGGSVVGDHSVILAGTGERITLSHHAEDRAIFARGAVKAAL 254

Query: 254 WAKSQIPGLYSMRDVLGI 271
           WA+ + PGLYSMRDVLG+
Sbjct: 255 WARGKKPGLYSMRDVLGL 272


>gi|84515136|ref|ZP_01002499.1| dihydrodipicolinate reductase [Loktanella vestfoldensis SKA53]
 gi|84511295|gb|EAQ07749.1| dihydrodipicolinate reductase [Loktanella vestfoldensis SKA53]
          Length = 287

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 166/271 (61%), Gaps = 2/271 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M  +P  +   G GRMGQ L+K +  +    L +++ R+G   IGQD+G  +G  P G+ 
Sbjct: 19  MTDTPGIVITGGSGRMGQMLVKAVLASDKCHLAAVLERTGHAWIGQDIGTAMGGQPAGVT 78

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +D+   A      +IDF++PA T+    ++AQ   VH+IGTTG S  + + I + AR+A
Sbjct: 79  VTDDALEAFARAQAVIDFTAPAATVGFAALAAQARAVHVIGTTGLSDDDIKAIDAAARHA 138

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  L +T A  L P  D+D EI+E HH +K+D+PSGTAL+LGEA A
Sbjct: 139 VIVRAGNMSLGVNLLVKLTQTVAAALDP--DFDIEIVEAHHNQKVDAPSGTALMLGEAAA 196

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V L D     R     AR  G IG +++R G IVGEH V+ A  GE I L H A D
Sbjct: 197 TGRGVTLADVRDAGRDGMTGARQRGDIGFSAIRGGDIVGEHDVIFAAAGERIVLRHLATD 256

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R IFARG+L AALW + + PG Y M DVLG+
Sbjct: 257 RAIFARGALKAALWGQDKAPGAYDMMDVLGL 287


>gi|119385522|ref|YP_916578.1| dihydrodipicolinate reductase [Paracoccus denitrificans PD1222]
 gi|119375289|gb|ABL70882.1| dihydrodipicolinate reductase [Paracoccus denitrificans PD1222]
          Length = 268

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L + +  +    L   I R G+P +G+D+G  +G   +GI  +D+   AI    
Sbjct: 13  GRMGQMLARTVLGSDQARLVGAIEREGNPWVGRDLGEAMGGPVLGITVTDDPVEAIAKAQ 72

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA T+    ++AQ   VH+IGTTGF   + + + + AR+API+++ NMSLG+N
Sbjct: 73  AVIDFTAPAATVAFAELTAQARAVHVIGTTGFEPADLDKLKAAARHAPIIRAGNMSLGVN 132

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L    A  L   +DWD E++E HH RK+D+PSGTAL+LGEA A GR   L D    
Sbjct: 133 LLVGLTRKVAAAL--GEDWDIEVVEAHHSRKVDAPSGTALMLGEAAAEGRGHGLDDLRTP 190

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  GSIG +++R G IVGEH V+ A  GE + L H A DR IFARG+L AAL
Sbjct: 191 AREGITGARAPGSIGFSAIRGGDIVGEHDVIFATAGERVILRHVATDRAIFARGALRAAL 250

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 251 WGQDKGPGEYDMADVLGL 268


>gi|86747561|ref|YP_484057.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris HaA2]
 gi|123409013|sp|Q2J314|DAPB_RHOP2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|86570589|gb|ABD05146.1| dihydrodipicolinate reductase [Rhodopseudomonas palustris HaA2]
          Length = 271

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 170/269 (63%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V G GGRMG+AL + I     + L   +   GS L+GQD G   G+   G++ S
Sbjct: 2   SDMRLIVAGAGGRMGRALTRAISETKGVVLTGALEAPGSELLGQDAGVLAGLPANGVELS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L     + DGI+DF+ P  T+ ++ I+AQ  IVH+IGTTG S  +N VI S  R A +
Sbjct: 62  ADLWTLSANADGILDFTVPGATIANVAIAAQRGIVHVIGTTGLSSSDNAVIQSVTRQAIV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L  L +  A+ L    ++D EI+EMHHR K+D+PSGTALLLGEA A G
Sbjct: 122 VKSGNMSLGVNLLAALTKRVAQSL--GDNFDIEIVEMHHRAKIDAPSGTALLLGEAAALG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V+L  H    R     AR  G IG ASLR G++ G+HSV+ AG  E I L+H A DR 
Sbjct: 180 RGVDLDSHSARGRDGLTGARKTGDIGFASLRGGTVTGDHSVIFAGPYERIELAHKAEDRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFA G+L AA WA  + PGLYSM DVLG+
Sbjct: 240 IFAHGALKAAQWAHGKKPGLYSMMDVLGL 268


>gi|126727799|ref|ZP_01743629.1| dihydrodipicolinate reductase [Rhodobacterales bacterium HTCC2150]
 gi|126702926|gb|EBA02029.1| dihydrodipicolinate reductase [Rhodobacterales bacterium HTCC2150]
          Length = 270

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 166/266 (62%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI + G  GRMGQ LIK +  +   TL  ++ R+G   +G+DVG  +G S  G+  +D+ 
Sbjct: 6   RIVITGASGRMGQMLIKAVEASDQATLGGVVERAGHDWVGRDVGEAMGGSANGVVVTDDP 65

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
             A  +   +IDF++PA T++   ++AQ  +VH+IGTTG   +    +   AR+A IV++
Sbjct: 66  LSAFANAQAVIDFTAPAATVEFAALAAQARLVHVIGTTGMGPEHLAKLGPAARHAVIVRA 125

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMSLG+N L  L    A  L    D+D E++E HHR K+D+PSGTAL+LGEA A+GR V
Sbjct: 126 GNMSLGVNLLTQLTRKVAAAL--DADFDIEVVEAHHRHKVDAPSGTALMLGEAAADGRGV 183

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           NL D     R     ART G IG +++R G +VGEH V+ A +GE I L H A DR IFA
Sbjct: 184 NLADVSDSGRDGITGARTRGDIGFSAIRGGDVVGEHDVIFAADGERIVLRHLATDRNIFA 243

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG+L AALW + + PG Y M DVLG+
Sbjct: 244 RGALKAALWGQDKKPGEYDMLDVLGL 269


>gi|126736598|ref|ZP_01752338.1| dihydrodipicolinate reductase [Roseobacter sp. CCS2]
 gi|126713911|gb|EBA10782.1| dihydrodipicolinate reductase [Roseobacter sp. CCS2]
          Length = 269

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 119/271 (43%), Positives = 167/271 (61%), Gaps = 2/271 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M  +P  +   G G+MGQ LI+ +  +    L  ++ RSG   +GQD+G  +G  P+G+ 
Sbjct: 1   MTDTPGIVITGGSGKMGQMLIRSVLASDKCHLVGVLERSGHDWVGQDIGTMMGGQPIGVD 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +D+          +IDF++PA T+    ++AQ   VH+IGTTG S  + + I++ AR+A
Sbjct: 61  VTDDAVEVFAKAQAVIDFTAPAATVDFAGLAAQARAVHVIGTTGLSEDDLKAINAAARHA 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  L +  A  L    D+D E++E HH +K+D+PSGTAL+LGEA A
Sbjct: 121 VIVRAGNMSLGVNLLVQLTKRVAAAL--DDDFDIEVIEAHHNQKVDAPSGTALMLGEAAA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V+L+D     R     AR +G IG +++R G IVGEH V+ A  GE I L H A D
Sbjct: 179 EGRGVSLSDVSDSGRDGITGARKKGDIGFSAIRGGDIVGEHDVLFAAAGERIVLRHLATD 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R IFARG+L AALW + + PG Y M DVLGI
Sbjct: 239 RAIFARGALKAALWGQDKNPGEYDMMDVLGI 269


>gi|310817249|ref|YP_003965213.1| dihydrodipicolinate reductase [Ketogulonicigenium vulgare Y25]
 gi|308755984|gb|ADO43913.1| dihydrodipicolinate reductase [Ketogulonicigenium vulgare Y25]
          Length = 268

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 118/258 (45%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L++E+  +    L   +VR GSP IGQDVG  +G  P+G+  SD+   A     
Sbjct: 13  GRMGQMLLREVLASSKCRLVGALVRVGSPWIGQDVGTMLGGQPIGVTVSDDAVAAFAKAQ 72

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
           G++DF+SP  +++   ++AQ   VH+IGTTGF     + + +  R+   V++ N SLG+N
Sbjct: 73  GVLDFTSPEASVEFAELAAQARAVHVIGTTGFEPAHIQKLLAATRHCVAVRAGNTSLGVN 132

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L    D+D EI+E HHR K+D+PSGTAL+LGEA A GR V+L      
Sbjct: 133 LLVKLTQQVAAAL--DADFDIEIVEAHHRNKVDAPSGTALMLGEAAAAGRGVDLDAVSDR 190

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG AS+R G +VGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 191 GRDGITGARERGHIGFASVRGGDVVGEHDVIFAANGERIVLRHLATDRAIFARGALKAAL 250

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W +++ PG Y M DVLG+
Sbjct: 251 WGQNKEPGAYDMMDVLGL 268


>gi|84684346|ref|ZP_01012247.1| dihydrodipicolinate reductase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667325|gb|EAQ13794.1| dihydrodipicolinate reductase [Rhodobacterales bacterium HTCC2654]
          Length = 269

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 161/258 (62%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L++ +  NP+  L   + R+G   IG+D+G  +G + +G+  +D+   A+    
Sbjct: 14  GRMGQMLVRLVSENPACRLVGALERAGHDWIGRDIGTAMGGAELGVTVTDDALDAMSRAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA T+    I+AQ   VH+IGTTG    +   + + AR+A +V++ NMS G+N
Sbjct: 74  AVIDFTAPAATVPLAEIAAQARAVHVIGTTGLDEDDIAKLDAAARHAVMVRAGNMSFGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L ET A  L    ++D EI+E HH+ K+D+PSGTAL+LGEA A GR V LTD    
Sbjct: 134 LLTKLTETVARAL--DVEFDIEIVEAHHKHKVDAPSGTALMLGEAAAEGRGVRLTDVADR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR EG IG +++R G IVGEH V+ AG GE I L H A DR IFARG++ AAL
Sbjct: 192 GRDGITGAREEGHIGFSAIRGGDIVGEHDVIFAGPGERIILRHVATDRAIFARGAVKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG Y M DVLG+
Sbjct: 252 WGIGRKPGAYDMMDVLGL 269


>gi|254437383|ref|ZP_05050877.1| dihydrodipicolinate reductase [Octadecabacter antarcticus 307]
 gi|198252829|gb|EDY77143.1| dihydrodipicolinate reductase [Octadecabacter antarcticus 307]
          Length = 293

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 122/274 (44%), Positives = 167/274 (60%), Gaps = 2/274 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M   P  +   G GRMGQ LI  +  + + TL  ++ R G   +GQDVG  +G + +G+ 
Sbjct: 22  MTDLPGIVVTGGSGRMGQMLINAVQASDACTLIGVLERVGHDWVGQDVGIAMGGAAIGVS 81

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            SD+   +  S   IIDF++PA T+    ++AQ   VH+IGTTG +  +   + + AR+A
Sbjct: 82  VSDDPVTSFASAQAIIDFTAPAATIGFAELAAQARAVHVIGTTGLTEGDIAKLDAAARHA 141

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  L +  A  L   +D+D EI+E HH  K+D+PSGTAL+LGEA A
Sbjct: 142 VIVRAGNMSLGVNLLVQLTKKVAAAL--DEDFDIEIIEAHHHHKIDAPSGTALMLGEAAA 199

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V L D     R     ART G IG  ++R G IVGEH V+ A  GE I L+H A D
Sbjct: 200 QGRGVVLKDVSDSGRDGITGARTRGDIGFTAIRGGDIVGEHDVLFAAAGERIKLTHIATD 259

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLD 274
           R +FARG+L AA+W ++Q PG Y+M DVLG+  D
Sbjct: 260 RAVFARGALKAAIWGQTQKPGSYTMFDVLGLSED 293


>gi|84500521|ref|ZP_00998770.1| dihydrodipicolinate reductase [Oceanicola batsensis HTCC2597]
 gi|84391474|gb|EAQ03806.1| dihydrodipicolinate reductase [Oceanicola batsensis HTCC2597]
          Length = 269

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 160/258 (62%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+ +  +    L   + R G   IGQD+G  +G   +G+  +D+ A A     
Sbjct: 14  GRMGQMLIETVRQSDRARLAGAVERQGHDWIGQDLGTCLGTGELGVTVTDDPARAFDGAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            ++DF++PA T+     +A+    H+IGTTGF  ++   I+  A+   IV++ NMSLG+N
Sbjct: 74  AVLDFTAPAATVAFARTAARAGAAHVIGTTGFGDEDLVAIADAAKETAIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV   A  L   +D+D E++E HH RK+D+PSGTAL+LGEA A GR V+L++    
Sbjct: 134 LLTMLVRKVAAAL--DEDYDIEVVEAHHNRKVDAPSGTALMLGEAAAGGRGVDLSEVSDR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR +G IG A +R G IVGEH V+ AG GE ITL H A DR +FARG+L AAL
Sbjct: 192 GRDGITGARRKGDIGFAVIRGGGIVGEHEVIFAGPGERITLRHVADDRALFARGALRAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           WA+ + PG YSM DVLG+
Sbjct: 252 WAQGREPGEYSMLDVLGL 269


>gi|260432191|ref|ZP_05786162.1| dihydrodipicolinate reductase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416019|gb|EEX09278.1| dihydrodipicolinate reductase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 269

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK I ++    L   + R+G   IGQDVG  +G  P+G+  +D+   A     
Sbjct: 14  GRMGQMLIKTITDSDQARLVGAVERTGHDWIGQDVGTAMGGQPLGVTVTDDPLEAFAQAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  TL+   ++AQ   VH+IGTTG S ++   +   AR+A IV++ NMSLG+N
Sbjct: 74  AVIDFTAPEATLEFAALAAQARCVHVIGTTGMSDEQIAALEPAARHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR VNL +    
Sbjct: 134 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVNLAEVADR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG  ++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 192 GRDGITGARQRGHIGFHAIRGGDIVGEHDVLFAAPGERIVLRHVATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQGKAPGQYDMVDVLGL 269


>gi|159045580|ref|YP_001534374.1| dihydrodipicolinate reductase [Dinoroseobacter shibae DFL 12]
 gi|189082794|sp|A8LL24|DAPB_DINSH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|157913340|gb|ABV94773.1| dihydrodipicolinate reductase [Dinoroseobacter shibae DFL 12]
          Length = 269

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 163/271 (60%), Gaps = 2/271 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M   P  +   G GRMG+ LI+ +  + +  L  +  R G   IG D+G  +G + +G+ 
Sbjct: 1   MSDVPGIVVTGGSGRMGRMLIETVRGSDAARLVGVTERPGHDWIGADIGVALGGAAIGVT 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +D+   A  +   +IDF+SPA T+    ++AQ   VH+IGTTGFS  +   + + AR+A
Sbjct: 61  VTDDPLEAFATAQAVIDFTSPAATVAHAELTAQARAVHVIGTTGFSPADLAHLEAAARHA 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  L E  A  L    D+D E++E HHR K+D+PSGTAL+LGEA A
Sbjct: 121 VIVRAGNMSLGVNLLVKLTEKVAAAL--DADYDIEVIEAHHRHKVDAPSGTALMLGEAAA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V L D     R      R  G IG +++R G IVGEH V+ A EGE ITL H A D
Sbjct: 179 AGRGVALADVSDRGRDGITGERKRGDIGFSAIRGGDIVGEHDVLFAAEGERITLRHVASD 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +FARG+L AALW + + PG Y M DVLG+
Sbjct: 239 RSVFARGALKAALWGQDKGPGAYDMMDVLGL 269


>gi|110678027|ref|YP_681034.1| dihydrodipicolinate reductase [Roseobacter denitrificans OCh 114]
 gi|123065910|sp|Q16CE5|DAPB_ROSDO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|109454143|gb|ABG30348.1| dihydrodipicolinate reductase [Roseobacter denitrificans OCh 114]
          Length = 272

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 172/269 (63%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +PM+I++ G  GRMG+ L+  I  + ++TL + + R G   IG+D+G  +G +  G+  S
Sbjct: 3   TPMKIAITGVSGRMGRMLVDTIDTSDAVTLSAALERPGHDWIGRDLGLALGGTERGVLVS 62

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++  A+   + +IDF+SPA T++    +A+   +H+IGTTG + +E   I + A  A I
Sbjct: 63  DDIDSALADSEAVIDFTSPAATIRFAQAAARVGAIHVIGTTGMTEQEIAQIDAQAAGAVI 122

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V++ NMSLG+N L  L +  A  L   +D+D E++E HH +K+D+PSGTAL+LGEA A G
Sbjct: 123 VRAGNMSLGVNLLVQLTKRVAAAL--DEDFDIEVIESHHNQKVDAPSGTALMLGEAAAEG 180

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V+L       R     AR +G IG  S+R G IVGEH V+ A +GE ITL H A DR 
Sbjct: 181 RGVSLDAVSDRGRDGLTGARQKGDIGFVSVRGGDIVGEHDVLFAAQGERITLRHVASDRS 240

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FARG+L AALWA+ + PG Y M DVLG+
Sbjct: 241 VFARGALKAALWARHRAPGAYDMLDVLGL 269


>gi|323136458|ref|ZP_08071540.1| dihydrodipicolinate reductase [Methylocystis sp. ATCC 49242]
 gi|322398532|gb|EFY01052.1| dihydrodipicolinate reductase [Methylocystis sp. ATCC 49242]
          Length = 271

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 174/267 (65%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+ V+G  GRMG+ L + I +   + L + +   G+  IG D G   G  P G+  + +
Sbjct: 4   LRLVVVGAAGRMGRMLTQVIPDTLGVRLVAALEAEGAATIGADSGAAFGQGPNGVPVTSD 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +A A+   D ++DFS PA T+     +A   + H+IGTTG S ++ + I++ AR   +V+
Sbjct: 64  VAAALAGADAVVDFSCPAATVAMAKAAAGAGVAHVIGTTGLSAEDLDAIAAAARETAVVR 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LVE AA+ L PA  WD EI+EMHHR K+D+PSGTALLLGEA+A GR 
Sbjct: 124 SGNMSLGVNLLAVLVERAAQALGPA--WDAEIVEMHHRLKVDAPSGTALLLGEALARGRG 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           ++L++H    R     AR  G IG ASLR G+++G+H+V  AG GE I LSH A DR IF
Sbjct: 182 IDLSEHSARGRDGMTGARKGGDIGFASLRGGTVIGDHTVYFAGAGERIELSHRAEDRGIF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG+L AALW + + PGLYSM DVLG+
Sbjct: 242 ARGALAAALWTRGKAPGLYSMADVLGL 268


>gi|254453843|ref|ZP_05067280.1| dihydrodipicolinate reductase [Octadecabacter antarcticus 238]
 gi|198268249|gb|EDY92519.1| dihydrodipicolinate reductase [Octadecabacter antarcticus 238]
          Length = 293

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 119/271 (43%), Positives = 163/271 (60%), Gaps = 2/271 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M   P  +   G GRMGQ LI  +  + +  L  ++ R+G   +GQDVG  +G + +G+ 
Sbjct: 22  MTDLPGIVVTGGSGRMGQMLINAVQASDACALVGVLERTGHDWVGQDVGIAMGGAEIGVT 81

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            SD+          +IDF++P  T+    ++AQ   VH+IGTTG +  +   + + AR+A
Sbjct: 82  VSDDAVTTFAKAQAVIDFTAPDATIGFAELAAQARAVHVIGTTGLTDGDIAKLDAAARHA 141

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  L +  A  L   +D+D EI+E HH  K+D+PSGTAL+LGEA A
Sbjct: 142 VIVRAGNMSLGVNLLVQLTKKVAAAL--DEDFDIEIIEAHHHHKIDAPSGTALMLGEAAA 199

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V L D     R     AR  G IG +++R G IVGEH V+ A  GE I L+H A D
Sbjct: 200 QGRGVALKDVTDSGRDGVTGARVRGDIGFSAIRGGDIVGEHDVLFAAAGERIKLTHIATD 259

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R IFARG+L AALW ++Q PG YSM DVLG+
Sbjct: 260 RAIFARGALKAALWGQTQKPGSYSMLDVLGL 290


>gi|146308637|ref|YP_001189102.1| dihydrodipicolinate reductase [Pseudomonas mendocina ymp]
 gi|166222665|sp|A4XYF4|DAPB_PSEMY RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|145576838|gb|ABP86370.1| dihydrodipicolinate reductase [Pseudomonas mendocina ymp]
          Length = 267

 Score =  221 bits (564), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 169/266 (63%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +      TL + I R+ S LIG D G  VG+  +G+  + +L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVSQAEGATLSAAIDRADSSLIGADAGELVGLGKIGVTLAGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDF+ P++TL++L +  Q     +IGTTGF+V+E + +S  A+  PIV +
Sbjct: 63  AAMVDDFDVLIDFTHPSVTLKNLEVCRQAGKAMVIGTTGFTVEEKQQLSEAAKQIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    D D EI+E HHR K+D+PSGTAL +GE +A+    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVADALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLQKVAVYGREGQTGARERETIGFATVRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ +ALW + + P LY M+DVLG+
Sbjct: 241 KGAVRSALWLQQRSPALYDMQDVLGL 266


>gi|300024829|ref|YP_003757440.1| dihydrodipicolinate reductase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526650|gb|ADJ25119.1| dihydrodipicolinate reductase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 266

 Score =  221 bits (564), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 168/267 (62%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I+V+G  GRMG+ LI  I   P   +       GSP +G+D+G   GI  +GI  S +
Sbjct: 1   MKIAVMGAAGRMGRQLIAAIAAEPQTMISGATEPIGSPALGKDIGELAGIERLGIAVSSD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +A  I + D IIDF+ P  T++  +++AQ    HIIGTTGF       I+  A    IVK
Sbjct: 61  VAAVIAAADAIIDFTVPKATVEFASLAAQSGTAHIIGTTGFEKAAEAAIAEAATKIAIVK 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMSLG+N L  L    A  L    D+D EI+EMHHR K+D+PSGTAL+LG+A A GR 
Sbjct: 121 AGNMSLGVNLLAALTRQVAAAL--GNDFDIEIVEMHHRMKIDAPSGTALMLGDAAAQGRD 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           ++L +H V  R      R  G IG A+LR G++VG+H+V+ AG+GE I L+H A DR IF
Sbjct: 179 LDLEEHSVRTRDGHTGPRHTGDIGFATLRGGTVVGDHTVIFAGDGERIELTHRAADRGIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALW K + PGLY+M DVLGI
Sbjct: 239 ARGAVKAALWTKDKPPGLYAMTDVLGI 265


>gi|86139375|ref|ZP_01057944.1| dihydrodipicolinate reductase [Roseobacter sp. MED193]
 gi|85823878|gb|EAQ44084.1| dihydrodipicolinate reductase [Roseobacter sp. MED193]
          Length = 269

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 118/271 (43%), Positives = 162/271 (59%), Gaps = 2/271 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M Q+P  +     GRMGQ LIK +  +    L  ++ R+G P +GQD+G  +G + +G+ 
Sbjct: 1   MTQTPSIVITGASGRMGQMLIKTVLESDKARLVGVVERTGHPWVGQDLGTAMGGAAIGVV 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +D+   A      +IDF+SP  TL    ++AQ   VH+IGTTG S  +   +   AR+A
Sbjct: 61  VTDDPLEAFSKAQAVIDFTSPEATLAFSKLAAQARAVHVIGTTGMSEAQIAQLEPAARHA 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            +V++ NMSLG+N L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A
Sbjct: 121 VLVRAGNMSLGVNLLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V L +     R     AR  G IG +++R G IVGEH V+ A  GE I L H A D
Sbjct: 179 EGRGVTLAEVSDSGRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAAAGERIVLRHMATD 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R IFARG+L AALW + + PG Y M DVLG+
Sbjct: 239 RAIFARGALKAALWGQDKAPGEYDMLDVLGL 269


>gi|325276148|ref|ZP_08141955.1| dihydrodipicolinate reductase [Pseudomonas sp. TJI-51]
 gi|324098724|gb|EGB96763.1| dihydrodipicolinate reductase [Pseudomonas sp. TJI-51]
          Length = 267

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 167/266 (62%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + + R  S L+G D G    +  +G+  SD+L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVQQQPGAGLTAAVDRPDSSLVGADAGELAALGRIGVLLSDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDF+ P++TL++L    +H    +IGTTGF+V+E ++++   ++ PIV +
Sbjct: 63  AKVVDEFDVLIDFTHPSVTLKNLAFCRKHGKAMVIGTTGFTVEEKQLLAEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLSLKLLDMAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 DLQEVAVYGREGQTGARDRKTIGFATVRAGDVVGDHTVLFAAEGERLEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AALW   + PGLY M+DVL +
Sbjct: 241 KGAVRAALWLDGREPGLYDMQDVLDL 266


>gi|149203492|ref|ZP_01880462.1| dihydrodipicolinate reductase [Roseovarius sp. TM1035]
 gi|149143325|gb|EDM31364.1| dihydrodipicolinate reductase [Roseovarius sp. TM1035]
          Length = 272

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 119/259 (45%), Positives = 160/259 (61%), Gaps = 2/259 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+ +  +P   L   + R G   IGQDVG  +G + +G+  +D+   AI    
Sbjct: 14  GRMGQMLIRTLAESPRAQLIGALERPGHDWIGQDVGRAMGGAEIGVTVTDDPLEAIARAH 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA TL+   ++AQ  +VH+IGTTGF  +    + + AR+A I+++ NMSLG+N
Sbjct: 74  AVIDFTAPAATLEFAILAAQARVVHVIGTTGFEAEHLPKLDAAARHAVIIRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D EI+E HH +K+D+PSGTAL+LGEA A GR V L      
Sbjct: 134 LLTQLTKRVAAAL--DEDFDIEIVEAHHNQKVDAPSGTALMLGEAAAEGRGVALERASDR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      RT G IG +++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 192 ARDGITGKRTRGHIGFSAIRGGDIVGEHDVIFAAAGERIVLRHIATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGIG 272
           W   + PG Y M DVLG+G
Sbjct: 252 WGLGRKPGSYDMIDVLGLG 270


>gi|126730445|ref|ZP_01746256.1| dihydrodipicolinate reductase [Sagittula stellata E-37]
 gi|126709178|gb|EBA08233.1| dihydrodipicolinate reductase [Sagittula stellata E-37]
          Length = 255

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 156/257 (60%), Gaps = 2/257 (0%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MGQ L+KE+  +  + L   + R G   +G+D+G  +G + MG+K SD+   A      +
Sbjct: 1   MGQMLVKEVMASDRLKLVGALEREGHDWVGRDLGLAMGGAEMGLKVSDDALEAFSRAQAV 60

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF++PA T+    ++AQ   VH+IGTTG S  +   I   AR+A +V++ NMSLG+N L
Sbjct: 61  IDFTAPAATVAFSELAAQARAVHVIGTTGLSEDDISAIDRAARHAVVVRAGNMSLGVNLL 120

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             +V+  A  L    DWD E++E HH  K+D+PSGTAL+LGEA A GR V L D     R
Sbjct: 121 TRMVKQVAAAL--DADWDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVALADVSDRGR 178

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                AR  G IG  ++R G IVGEH V+ A  GE I L H A DR +FARG+L AALW 
Sbjct: 179 DGITGARKRGDIGFHAIRGGDIVGEHEVLFATPGERIVLKHVASDRTLFARGALKAALWG 238

Query: 256 KSQIPGLYSMRDVLGIG 272
           + + PG Y M DVLG+G
Sbjct: 239 QDKGPGHYDMLDVLGLG 255


>gi|26991408|ref|NP_746833.1| dihydrodipicolinate reductase [Pseudomonas putida KT2440]
 gi|37999616|sp|Q88DU4|DAPB_PSEPK RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|24986478|gb|AAN70297.1|AE016670_7 dihydrodipicolinate reductase [Pseudomonas putida KT2440]
          Length = 267

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 165/264 (62%), Gaps = 3/264 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  SD+L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVQQTPGAGLTAAIDRPDSSLVGADAGELAALGRIGVLLSDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +H    IIGTTGF+V+E ++++   ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKHGKAMIIGTTGFTVEEKQLLAEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLSLKLLDMAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 DLQEVAVYGREGQTGARDRKTIGFATVRAGDVVGDHTVLFAAEGERLEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVL 269
           +G++ AALW   + PGLY M+DVL
Sbjct: 241 KGAVRAALWLDGREPGLYDMQDVL 264


>gi|167035717|ref|YP_001670948.1| dihydrodipicolinate reductase [Pseudomonas putida GB-1]
 gi|189082801|sp|B0KIS3|DAPB_PSEPG RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166862205|gb|ABZ00613.1| Dihydrodipicolinate reductase [Pseudomonas putida GB-1]
          Length = 267

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 164/264 (62%), Gaps = 3/264 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  SD+L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVQQTPGAGLTAAIDRPDSSLVGADAGELAALGRIGVLLSDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +H    IIGTTGFSV+E ++++   ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKHGKAMIIGTTGFSVEEKQLLAEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLSLKLLDMAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           NL +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 NLQEVAVYGREGQTGARDRKTIGFATVRAGDVVGDHTVLFAAEGERLEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVL 269
           +G++ AALW   + P LY M+DVL
Sbjct: 241 KGAVRAALWLDGREPALYDMQDVL 264


>gi|209966423|ref|YP_002299338.1| dihydrodipicolinate reductase [Rhodospirillum centenum SW]
 gi|209959889|gb|ACJ00526.1| dihydrodipicolinate reductase [Rhodospirillum centenum SW]
          Length = 265

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 122/267 (45%), Positives = 169/267 (63%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI ++G  GRMGQ L++E+   P  TL     R GS  +G+D+G   G+ P+G+  +D+
Sbjct: 1   MRIGIVGAAGRMGQMLVREVAATPGCTLAGGTERPGSANLGRDLGTLAGLEPLGVAATDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
            A   ++ D +IDF++PA ++    ++A+     ++GTTG S ++   ++  A  AP+V 
Sbjct: 61  AAALFRAADAVIDFTAPAASVAHARLAAETGTALVVGTTGLSEQDRAALADSATRAPVVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMSLG+N L  LV   A  L P  DWD EILEMHHR K+D+PSGTAL LG+A A GR 
Sbjct: 121 AANMSLGVNLLLGLVRKVASTLGP--DWDIEILEMHHRHKVDAPSGTALALGQAAAEGRA 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L       R      R  G IG A+LR G +VG+H+V+ A EGE I L+H A  R IF
Sbjct: 179 VALETVRRSVRDGHTGPRPAGEIGFATLRGGDVVGDHTVIFAAEGERIELTHKAASRAIF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALWA +Q PG YSM+DVLG+
Sbjct: 239 ARGAVRAALWAPTQPPGFYSMQDVLGL 265


>gi|294675832|ref|YP_003576447.1| dihydrodipicolinate reductase [Rhodobacter capsulatus SB 1003]
 gi|294474652|gb|ADE84040.1| dihydrodipicolinate reductase [Rhodobacter capsulatus SB 1003]
          Length = 273

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+ L   +  +    L   + R+G   IG+D+G  +G +  G+  SD+   A     
Sbjct: 18  GRMGRMLAATVAASDKARLVGAVERTGHDWIGRDLGEALGGAKNGVIVSDDPLEAFAKAQ 77

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA TL+   ++AQ   VH+IGTTGF  ++   +   +R++  +++ NMSLG+N
Sbjct: 78  AVIDFTAPAATLEFARLAAQARAVHVIGTTGFEKEQIAALEPASRHSVQIRAGNMSLGVN 137

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +T A  L    DWD E++E HH RK+D+PSGTAL+LG+A A GR ++L      
Sbjct: 138 LLTKLAKTVAAAL--DADWDIEVVEAHHNRKVDAPSGTALMLGQAAAEGRGIDLDGMTES 195

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            RH    AR  G+IG +++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 196 GRHGITGARKHGAIGFSAIRGGDIVGEHDVIFAAAGERIVLRHIATDRAIFARGALRAAL 255

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W +SQ PG Y M DVLGI
Sbjct: 256 WGQSQKPGQYDMIDVLGI 273


>gi|254511691|ref|ZP_05123758.1| dihydrodipicolinate reductase [Rhodobacteraceae bacterium KLH11]
 gi|221535402|gb|EEE38390.1| dihydrodipicolinate reductase [Rhodobacteraceae bacterium KLH11]
          Length = 276

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 115/258 (44%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK + ++    L  ++ R+G   IG+DVG  +G +P G+  +D+   A     
Sbjct: 21  GRMGQMLIKTVTDSDQARLVGVVERTGHDWIGRDVGEAMGGAPRGVTVTDDPLEAFAQAQ 80

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  TL+   ++AQ   VH+IGTTG + ++   +   +R+A IV++ NMSLG+N
Sbjct: 81  AVIDFTAPEATLEFAALAAQARCVHVIGTTGMTDEQIAALEPASRHAVIVRAGNMSLGVN 140

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V L D    
Sbjct: 141 LLVQLTKKVAAAL--DEDFDIEVIEGHHHHKVDAPSGTALMLGEAAAEGRGVKLADVSDR 198

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG  ++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 199 GRDGITGARKRGDIGFHAIRGGDIVGEHDVLFAAPGERIVLRHLATDRAIFARGALKAAL 258

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 259 WGQGKAPGQYDMVDVLGL 276


>gi|89056528|ref|YP_511979.1| dihydrodipicolinate reductase [Jannaschia sp. CCS1]
 gi|88866077|gb|ABD56954.1| dihydrodipicolinate reductase [Jannaschia sp. CCS1]
          Length = 269

 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 119/267 (44%), Positives = 165/267 (61%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M I+V+G  GRMG+ LI+ I  +    L ++  R G   +G D+G  +G S  G+   D+
Sbjct: 4   MGIAVMGASGRMGRMLIQTITASERAHLVAVTERPGHDWVGADLGEALGGSASGVPVVDD 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              AI     +IDF+SP  T+    ++AQ   VH+IGTTG S  + EV+ + AR+A IV+
Sbjct: 64  PLEAIVKAQAVIDFTSPEATVAHAKLTAQARAVHVIGTTGLSDADIEVLDACARHACIVR 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMSLG+N L  L +  A  L   +D+D E++E HHR K+D+PSGTAL+LGEA A GR 
Sbjct: 124 AGNMSLGVNLLVRLTQQVAAAL--DEDFDIEVVEAHHRHKVDAPSGTALMLGEAAAQGRG 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V+L D     R     AR  G IG +++R G +VGEH V+ A +GE + L H A DR IF
Sbjct: 182 VDLGDVKDSGRDGITGARGRGDIGFSAIRGGDVVGEHDVIFAADGERVVLRHLATDRAIF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +RG+L AALW + + PG YSM  VLG+
Sbjct: 242 SRGALKAALWGQGRAPGHYSMMSVLGL 268


>gi|254477355|ref|ZP_05090741.1| dihydrodipicolinate reductase [Ruegeria sp. R11]
 gi|214031598|gb|EEB72433.1| dihydrodipicolinate reductase [Ruegeria sp. R11]
          Length = 273

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 115/258 (44%), Positives = 160/258 (62%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+ I +NPS  L   + RSG   +GQD+G  +G + +G+  +D+   A     
Sbjct: 18  GRMGQMLIRTILDNPSARLVGAVERSGHQWVGQDIGAAMGGAEVGVTVTDDALEAFSKAQ 77

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+ P  TL   +++AQ   VH+IGTTG S ++   +   +R+   V++ NMSLG+N
Sbjct: 78  AVIDFTGPEATLAFADLAAQARAVHVIGTTGMSDEQIAKLEPASRHCAQVRAGNMSLGVN 137

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V+L++    
Sbjct: 138 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVSLSEVSDS 195

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG +++R G IVGEH V+ AG+GE I L H A DR IFARG++ AAL
Sbjct: 196 GRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAGQGERIVLRHLATDRAIFARGAVKAAL 255

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG Y M DVLG+
Sbjct: 256 WGLGKEPGQYDMVDVLGL 273


>gi|163734259|ref|ZP_02141699.1| dihydrodipicolinate reductase [Roseobacter litoralis Och 149]
 gi|161392267|gb|EDQ16596.1| dihydrodipicolinate reductase [Roseobacter litoralis Och 149]
          Length = 302

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 171/269 (63%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +PM+I++ G  GRMG+ L++ I  + ++T+ + + R G   IG+D+G  +G +  G+  S
Sbjct: 33  TPMKIAITGVSGRMGRMLLETIDASDAVTVSAALERPGHDWIGRDLGLALGGAERGVLVS 92

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++  A+   + +IDF+SPA T++    +A+   +H+IGTTG + +E   + + +  A I
Sbjct: 93  DDIDSALADSEAVIDFTSPAATIRFAQAAARVGAIHVIGTTGMTEQEIAQLDAQSAGAVI 152

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V++ NMSLG+N L  L +  A  L    D+D EI+E HH +K+D+PSGTAL+LGEA A G
Sbjct: 153 VRAGNMSLGVNLLVQLTKRVAAAL--DDDFDIEIIESHHNQKVDAPSGTALMLGEAAAEG 210

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V+L       R     AR +G IG  S+R G IVGEH V+ A  GE ITL H A DR 
Sbjct: 211 RGVSLDAVSDRGRDGLTGARQKGDIGFVSVRGGDIVGEHDVLFAALGERITLRHVASDRS 270

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FARG+L AALWA+ + PG Y M DVLG+
Sbjct: 271 VFARGALKAALWARGRAPGAYDMLDVLGL 299


>gi|260574497|ref|ZP_05842501.1| dihydrodipicolinate reductase [Rhodobacter sp. SW2]
 gi|259023393|gb|EEW26685.1| dihydrodipicolinate reductase [Rhodobacter sp. SW2]
          Length = 269

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 115/258 (44%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L++ + ++    L   + R G   IG+D+G  +G + +G+  +D+   A+    
Sbjct: 14  GRMGQMLVRTVLSSGKARLVGCLERPGHGWIGRDIGECLGGAAVGVLVTDDPLAALAKAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            ++DF++PA T+    + AQ   VH+IGTTG    +   I+  A +A IV++ NMSLG+N
Sbjct: 74  ALLDFTAPAATVAFSGLCAQARAVHVIGTTGLEAGDIAAINRAAHHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A+ L    DWD E++E HHRRK+D+PSGTAL+LG+A A+GR V+L      
Sbjct: 134 LLVRLTQKVAQAL--DADWDIEVVEAHHRRKVDAPSGTALMLGQAAADGRGVDLDAVRDA 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG AS+R G IVGEH V+ A +GE I L H A DR IFARG+L AAL
Sbjct: 192 GRDGITGARRRGDIGFASIRGGDIVGEHEVIFAADGERIALRHVATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + Q PG Y M DVLG+
Sbjct: 252 WGQGQKPGAYDMMDVLGL 269


>gi|56698645|ref|YP_169022.1| dihydrodipicolinate reductase [Ruegeria pomeroyi DSS-3]
 gi|81558236|sp|Q5LLT7|DAPB_SILPO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|56680382|gb|AAV97048.1| dihydrodipicolinate reductase [Ruegeria pomeroyi DSS-3]
          Length = 269

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L++ + ++  + L   + R G   IG+DVG  +G   +G+  +D+   A     
Sbjct: 14  GRMGQMLVRTVTDSDKVRLVGALERPGHDWIGRDVGEAMGGQALGVAVTDDPLEAFAQAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA TL    ++AQ   VH+IGTTG + ++   +   AR+A IV++ NMSLG+N
Sbjct: 74  AVIDFTAPAATLGFAALAAQARCVHVIGTTGMTAEQIAALEPAARHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V L D    
Sbjct: 134 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVRLDDVADR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     ART G IG  ++R G IVGEH V+ A  GE I L H A DR +FARG+L AAL
Sbjct: 192 ARDGITGARTRGDIGFHAIRGGDIVGEHDVLFAAPGERIVLRHVASDRAVFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQGKAPGHYDMVDVLGL 269


>gi|226946319|ref|YP_002801392.1| dihydrodipicolinate reductase [Azotobacter vinelandii DJ]
 gi|259586127|sp|C1DFM1|DAPB_AZOVD RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226721246|gb|ACO80417.1| dihydrodipicolinate reductase [Azotobacter vinelandii DJ]
          Length = 267

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 163/266 (61%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ALI+     P   L + I R  S L+G D G   G   +G+  S  L
Sbjct: 3   RIAVMGAAGRMGKALIEAARQAPGAGLTAAIGRPDSTLVGVDAGELAGQGRIGVSLSGEL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDF+ P +TL++L+I  +     +IGTTGFS  E  ++   AR  PIV +
Sbjct: 63  ATVLDRFDVLIDFTHPTVTLKNLDICRRAGKAMVIGTTGFSADERRMLDEAAREIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI+E HHR K+D+PSGTAL +GE +A+    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEIVEAHHRHKVDAPSGTALRMGEVVASALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  ART  +IG A++RAG IVG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 DLQKVAVYGREGQTGARTRETIGFATVRAGDIVGDHTVLFAAEGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AALW + + P LY M+DVLG+
Sbjct: 241 KGAVRAALWLEGRDPALYDMQDVLGL 266


>gi|260426209|ref|ZP_05780188.1| dihydrodipicolinate reductase [Citreicella sp. SE45]
 gi|260420701|gb|EEX13952.1| dihydrodipicolinate reductase [Citreicella sp. SE45]
          Length = 271

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 116/272 (42%), Positives = 160/272 (58%), Gaps = 2/272 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M + P  +     GRMGQ L++E+  +  + L   + R G+  +G+D+G  +G +  GI 
Sbjct: 1   MTEKPGVVVTGVSGRMGQMLVREVQKSDRLKLVGAVERPGNDWVGRDLGLCMGGTETGIT 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +D+   A      +IDF+SPA T+    ++AQ   VH+IGTTG S  +   I   AR+A
Sbjct: 61  VTDDALEAFARAQAVIDFTSPAATVGFAELAAQARAVHVIGTTGLSDDDLRKIHVAARHA 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  +    A  L    DWD EI+E HH +K+D+PSGTAL+LGEA A
Sbjct: 121 VIVRAGNMSLGVNLLTRITRQVAAAL--DADWDIEIIESHHNQKVDAPSGTALMLGEAAA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V L++     R      R  G IG  ++R G +VGEH V+ A  GE I L H A D
Sbjct: 179 EGRGVALSEVSDRGRDGITGKRERGHIGFHAIRGGDVVGEHEVIFATAGERIVLKHLASD 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
           R +FARG+L AALW + + PG Y M DVLG+G
Sbjct: 239 RTLFARGALKAALWGQDKAPGEYDMLDVLGLG 270


>gi|104780014|ref|YP_606512.1| dihydrodipicolinate reductase [Pseudomonas entomophila L48]
 gi|166222664|sp|Q1IF57|DAPB_PSEE4 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|95109001|emb|CAK13697.1| dihydrodipicolinate reductase [Pseudomonas entomophila L48]
          Length = 267

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 110/264 (41%), Positives = 163/264 (61%), Gaps = 3/264 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+   D+L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVQQTPGAGLTAAIDRPDSSLVGADAGELAALGRIGVLLCDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDF+ P++TL++L    +     IIGTTGFSV+E ++++   +  PIV +
Sbjct: 63  AKVVDEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSVEEKQLLAEAGKEIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLSLKLLDMAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 DLQEVAVYGREGQTGARDRKTIGFATVRAGDVVGDHTVLFAAEGERLEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVL 269
           +G++ AALW   + PGLY M+DVL
Sbjct: 241 KGAVRAALWLDGREPGLYDMQDVL 264


>gi|148549793|ref|YP_001269895.1| dihydrodipicolinate reductase [Pseudomonas putida F1]
 gi|166222666|sp|A5W9A1|DAPB_PSEP1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|148513851|gb|ABQ80711.1| dihydrodipicolinate reductase [Pseudomonas putida F1]
 gi|313500634|gb|ADR62000.1| Dihydrodipicolinate reductase [Pseudomonas putida BIRD-1]
          Length = 267

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/264 (41%), Positives = 164/264 (62%), Gaps = 3/264 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +       L + I R  S L+G D G    +  +G+  SD+L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVQQTSGAGLTAAIDRPDSSLVGADAGELAALGRIGVLLSDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +H    IIGTTGF+V+E ++++   ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKHGKAMIIGTTGFTVEEKQLLAEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLSLKLLDMAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 DLQEVAVYGREGQTGARDRKTIGFATVRAGDVVGDHTVLFAAEGERLEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVL 269
           +G++ AALW   + PGLY M+DVL
Sbjct: 241 KGAVRAALWLDGREPGLYDMQDVL 264


>gi|254486259|ref|ZP_05099464.1| dihydrodipicolinate reductase [Roseobacter sp. GAI101]
 gi|214043128|gb|EEB83766.1| dihydrodipicolinate reductase [Roseobacter sp. GAI101]
          Length = 256

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 115/256 (44%), Positives = 155/256 (60%), Gaps = 2/256 (0%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MGQ LI ++  N  + L   I R G   +GQDVG  +G + +G+  +D+   AI     +
Sbjct: 1   MGQMLIGQVSANDRVRLVGAIERPGHAWVGQDVGVAMGGAALGVIVTDDPLEAIAPAQAV 60

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF++P  TL+   + AQ   VH+IGTTG + ++   +   AR+A IV++ NMSLG+N L
Sbjct: 61  IDFTAPEATLEFAALCAQARAVHVIGTTGMTEEQIAALEPAARHAVIVRAGNMSLGVNLL 120

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L +  A  L    D+D EI+E HH +K+D+PSGTAL+LGEA A GR V L D     R
Sbjct: 121 TQLTKRVAAAL--DDDFDIEIIEAHHNQKVDAPSGTALMLGEAAAEGRGVKLADVSDRGR 178

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                AR  G IG A++R G IVGEH V+ A  GE I L H A DR +FARG++ AALW 
Sbjct: 179 DGITGARKRGDIGFAAIRGGDIVGEHDVLFAAAGERIILRHLATDRAVFARGAIKAALWG 238

Query: 256 KSQIPGLYSMRDVLGI 271
           + + PG Y M DVLG+
Sbjct: 239 QGKAPGAYDMLDVLGL 254


>gi|126740778|ref|ZP_01756463.1| dihydrodipicolinate reductase [Roseobacter sp. SK209-2-6]
 gi|126718074|gb|EBA14791.1| dihydrodipicolinate reductase [Roseobacter sp. SK209-2-6]
          Length = 269

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 113/258 (43%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK +  +    L  ++ R G   +G+DVG  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLIKTVLESDKAHLAGVVEREGHDWVGRDVGEAMGGAAIGVTVTDDPLEAFAKAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  TL    ++AQ   VH+IGTTG + ++   +   +R+A I+++ NMSLG+N
Sbjct: 74  AVIDFTAPEATLAFSKLAAQARAVHVIGTTGMNEEQIAQLEPASRHATIIRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V LTD    
Sbjct: 134 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVKLTDVSDS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG +++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 192 GRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAAAGERIVLRHMATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQDKAPGEYDMLDVLGL 269


>gi|254461395|ref|ZP_05074811.1| dihydrodipicolinate reductase [Rhodobacterales bacterium HTCC2083]
 gi|206677984|gb|EDZ42471.1| dihydrodipicolinate reductase [Rhodobacteraceae bacterium HTCC2083]
          Length = 269

 Score =  215 bits (547), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 160/271 (59%), Gaps = 2/271 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M ++P  +     GRMGQ LIK I  + +  L   + R G   +G+DVG  +G + +G++
Sbjct: 1   MTETPGIVVTGASGRMGQMLIKTIQESDAALLVGALERPGHDWVGRDVGVAMGEAEVGLQ 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +D+          +IDF+SP  ++    ++AQ   VH+IGTTGF        +  AR+A
Sbjct: 61  VTDDPLEVFAKAQAVIDFTSPDASVAFAGLAAQARAVHVIGTTGFEDHHLAAFTVAARHA 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A
Sbjct: 121 TIVRAGNMSLGVNLLTQLTKKVAAAL--DEDFDIEVIEAHHNMKVDAPSGTALMLGEAAA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR VNL D     R     AR  G IG  ++R G IVGEH V+ A  GE I + H A D
Sbjct: 179 EGRGVNLKDVRDSGRDGITGARKRGDIGFTAIRGGDIVGEHDVLFAAAGERIVIRHMATD 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           RR+F+RG+L AALW + + PG Y M DVLG+
Sbjct: 239 RRVFSRGALKAALWGQGKAPGEYDMLDVLGL 269


>gi|330504841|ref|YP_004381710.1| dihydrodipicolinate reductase [Pseudomonas mendocina NK-01]
 gi|328919127|gb|AEB59958.1| dihydrodipicolinate reductase [Pseudomonas mendocina NK-01]
          Length = 267

 Score =  215 bits (547), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 165/266 (62%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +       L + + R+ S LIG D G  VG+  +G+    +L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVSQAEGAKLSAAVDRADSSLIGADAGELVGLGKIGVTLVGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDF+ P++TL+SL +  Q     +IGTTGF+ +E   +S  A+  PIV +
Sbjct: 63  AAVLDDFDVLIDFTHPSVTLKSLEVCRQAGKAMVIGTTGFTPEEKRRLSEAAKQIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    D D EI+E HHR K+D+PSGTAL +GE +A+    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVADALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLRKVAVYGREGQTGARERETIGFATVRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ +ALW + + P LY M+DVLG+
Sbjct: 241 KGAVRSALWLQQRSPALYDMQDVLGL 266


>gi|254463867|ref|ZP_05077278.1| dihydrodipicolinate reductase [Rhodobacterales bacterium Y4I]
 gi|206684775|gb|EDZ45257.1| dihydrodipicolinate reductase [Rhodobacterales bacterium Y4I]
          Length = 269

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/258 (43%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK +  +   TL + + R G   +G+DVG  +G +P G+  + +   A     
Sbjct: 14  GRMGQMLIKTVLESDKATLVAAVEREGHAWVGRDVGEMMGGAPAGVTVTADALEAFSKAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  TL    ++AQ   VH+IGTTG + ++   +   +R+A I+++ NMSLG+N
Sbjct: 74  AVIDFTAPEATLAFSKLAAQARAVHVIGTTGMTDEQIAQLEPASRHAVIIRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V L D    
Sbjct: 134 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVKLADVRDS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG  ++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 192 GRDGITGARKRGDIGFTAIRGGDIVGEHDVLFAAAGERIVLRHLATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQDKGPGQYDMVDVLGL 269


>gi|261856158|ref|YP_003263441.1| dihydrodipicolinate reductase [Halothiobacillus neapolitanus c2]
 gi|261836627|gb|ACX96394.1| dihydrodipicolinate reductase [Halothiobacillus neapolitanus c2]
          Length = 268

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 165/267 (61%), Gaps = 5/267 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V G  GRMG+ L++    NP   L + +VR GSPL+GQD G   G+  +     D+L
Sbjct: 4   RIAVAGVNGRMGRVLVEATVQNPDTILGAALVRQGSPLVGQDAGQLAGVGILNCAIDDDL 63

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           +      D +IDF+S   TL++L +    +   +IGTTGFS ++  ++S   ++ P+V +
Sbjct: 64  SRVSSDFDVLIDFTSIDATLENLAVCRAQHRAMVIGTTGFSAEQKVMLSEAGQDIPLVFA 123

Query: 126 SNMSLGIN-FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
            NMS+G+N  LG + +TA    L  + +D EI+E HHR K+D+PSGTAL LGEA+A    
Sbjct: 124 PNMSIGVNVLLGVVAQTAR---LLGEGYDVEIIEAHHRHKVDAPSGTALRLGEAVAEAYD 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R     AR   +IG A++R G +VG+H+V+ AG GE I L+H A  R  F
Sbjct: 181 RDLAEVAVYGREGHTGARDPQTIGFATVRGGDVVGDHTVLFAGIGERIELTHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W K+Q PGLY M+DVLG+
Sbjct: 241 AQGAVRAATWLKNQPPGLYDMQDVLGL 267


>gi|152995179|ref|YP_001340014.1| dihydrodipicolinate reductase [Marinomonas sp. MWYL1]
 gi|150836103|gb|ABR70079.1| Dihydrodipicolinate reductase [Marinomonas sp. MWYL1]
          Length = 266

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 166/267 (62%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  GRMG+ LI  IH+   ++L + I++ GS LIG D G   G+  +G+    +
Sbjct: 1   MRVAVIGASGRMGKNLITAIHDAKDVSLGAAILKPGSSLIGADAGEIAGVGKLGVAAVAS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  +   D +IDF++P+LTL++ +  A+H    ++GTTG +  E   ++  A+ + +V 
Sbjct: 61  LADCVNDFDVLIDFTTPSLTLENADFCAKHQKAIVVGTTGLNDAEKAKLNDAAQQSAVVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+ TAA+ L    ++D EI+E HHR K+DSPSGTAL +GE +A    
Sbjct: 121 APNMSVGVNLTLKLLATAAKIL--GDEYDVEIVEAHHRHKVDSPSGTALRMGEVVAEALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  R  Q  ART+  IG  ++RAG +VGEHSV  A EGE I + H A  R  F
Sbjct: 179 RDLKDCAVYGREGQTGARTQKEIGFETIRAGDVVGEHSVWFATEGERIEIVHKASSRMTF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W + +  G+Y M+DVL +
Sbjct: 239 AKGAVRAASWLEGKSAGMYDMQDVLNL 265


>gi|85703967|ref|ZP_01035070.1| dihydrodipicolinate reductase [Roseovarius sp. 217]
 gi|85671287|gb|EAQ26145.1| dihydrodipicolinate reductase [Roseovarius sp. 217]
          Length = 272

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 119/259 (45%), Positives = 160/259 (61%), Gaps = 4/259 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+ +  +P   L   + R G   IGQDVG  +G + +G+  +D+    I    
Sbjct: 14  GRMGQMLIRTLAESPRARLIGALERPGHAWIGQDVGRAMGGAEVGVTVTDDPLEVIARAH 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA TL+   ++AQ  +VH+IGTTGF   +   + + AR+A IV++ NMSLG+N
Sbjct: 74  ALIDFTAPAATLEFAILAAQARVVHVIGTTGFEADDLRHLDAAARHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMV- 192
            L  L +  A  L   +D+D EI+E HH +K+D+PSGTAL+LGEA A GR V L DH+  
Sbjct: 134 LLTQLTKRVAAAL--DEDFDIEIIEAHHNQKVDAPSGTALMLGEAAAEGRGVTL-DHVSD 190

Query: 193 LNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAA 252
             R      R  G IG +++R G IVGEH V+ A  GE I L H A DR IFARG+L AA
Sbjct: 191 RARDGITGKRMRGHIGFSAIRGGDIVGEHDVIFAAAGERIVLRHIATDRAIFARGALKAA 250

Query: 253 LWAKSQIPGLYSMRDVLGI 271
           LW   + PG Y M DVLG+
Sbjct: 251 LWGLGRKPGSYDMIDVLGL 269


>gi|28871637|ref|NP_794256.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213966660|ref|ZP_03394811.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tomato T1]
 gi|301383170|ref|ZP_07231588.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063395|ref|ZP_07254936.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tomato K40]
 gi|302133768|ref|ZP_07259758.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|37999560|sp|Q87WP2|DAPB_PSESM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|28854889|gb|AAO57951.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213928510|gb|EEB62054.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tomato T1]
 gi|331016635|gb|EGH96691.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 267

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 163/266 (61%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + + R  S L+G D G    +  +G+  SD+L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAVDRPDSTLVGADAGELAALGRIGVPLSDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVMDEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSIGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|83644088|ref|YP_432523.1| dihydrodipicolinate reductase [Hahella chejuensis KCTC 2396]
 gi|123534486|sp|Q2SMM6|DAPB_HAHCH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|83632131|gb|ABC28098.1| dihydrodipicolinate reductase [Hahella chejuensis KCTC 2396]
          Length = 267

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 163/266 (61%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+++G  GRMG+ L++ + +NP  +L +  VR GS L+G D G   G+   G+   D+L
Sbjct: 3   RIAIVGASGRMGKVLVEAVCDNPDASLGAASVRVGSSLVGADAGEIAGLGKKGVACVDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D IIDF+SP  TL+ L +  +     +IGTTGFS ++  +++  A++ P+V +
Sbjct: 63  AQVMDDFDVIIDFTSPETTLELLALCRKEGKAIVIGTTGFSDQQKTLLAEAAQDCPVVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N L  ++   A+ L    D+D E++E HHR K D+PSGTAL LGE +A     
Sbjct: 123 PNMSVGVNLLLNILALTAKTL--GDDYDVEVIEAHHRFKKDAPSGTALRLGEVVAEAMGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           NL +  V  R      R + +IG  ++RAG IVGEH+V+ A  GE I ++H A  R  FA
Sbjct: 181 NLNECAVYGREGITGERDKKTIGFETIRAGDIVGEHTVMFATMGERIEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AALW     PGLY M+DVLG+
Sbjct: 241 KGAVKAALWLHGVAPGLYDMQDVLGL 266


>gi|237798550|ref|ZP_04587011.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021403|gb|EGI01460.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 267

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 163/266 (61%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + + R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAVDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + ++   ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLAEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSIGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAAEGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W + + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLEGKAPGLYDMQDVLGL 266


>gi|255264583|ref|ZP_05343925.1| dihydrodipicolinate reductase [Thalassiobium sp. R2A62]
 gi|255106918|gb|EET49592.1| dihydrodipicolinate reductase [Thalassiobium sp. R2A62]
          Length = 273

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+ +  N ++ L   + RSG   +G+DVG  +G S +G+  +D+   A     
Sbjct: 14  GRMGQMLIQTVTQNDAVRLVGAVERSGHDWVGRDVGAAMGGSDLGVVVTDDALAAFSKAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  T++   ++AQ   VH+IGTTG +  +   +   +R+A IV++ NMSLG+N
Sbjct: 74  IVIDFTAPVATIEFAGLAAQARAVHVIGTTGMTDDDIAKLEPASRHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V L D    
Sbjct: 134 LLVQLTKKVAAAL--DEDFDIEVIEGHHNMKVDAPSGTALMLGEAAAEGRGVALNDVRDS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG  ++R G IVGEH V+ A  GE I L H A DR IFARG++ AAL
Sbjct: 192 GRDGITGARKRGDIGFTAIRGGDIVGEHDVLFAAAGERIVLRHMATDRAIFARGAVKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W  +Q PG Y M DVLG+
Sbjct: 252 WGVNQSPGEYDMLDVLGL 269


>gi|66047420|ref|YP_237261.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. syringae
           B728a]
 gi|75500693|sp|Q4ZNP9|DAPB_PSEU2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|63258127|gb|AAY39223.1| Dihydrodipicolinate reductase [Pseudomonas syringae pv. syringae
           B728a]
 gi|330969638|gb|EGH69704.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 267

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 161/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLEEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A+LRAG IVG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATLRAGDIVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|153825881|ref|ZP_01978548.1| dihydrodipicolinate reductase [Vibrio cholerae MZO-2]
 gi|149740379|gb|EDM54510.1| dihydrodipicolinate reductase [Vibrio cholerae MZO-2]
          Length = 269

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 62  LEQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGNTGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDVLGL 266


>gi|163744094|ref|ZP_02151460.1| dihydrodipicolinate reductase [Phaeobacter gallaeciensis 2.10]
 gi|161382641|gb|EDQ07044.1| dihydrodipicolinate reductase [Phaeobacter gallaeciensis 2.10]
          Length = 273

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK I ++P   L   + R G   +GQDVG  +G S +GI  +D+   A     
Sbjct: 18  GRMGQMLIKTIADHPRAHLVGAVEREGHDWVGQDVGLAMGGSEIGITVTDDAPAAFAKAQ 77

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+SP  T+    ++A+  +VH+IGTTG +  +   +   +R +  +++ NMSLG+N
Sbjct: 78  AVIDFTSPEATIAFAGMAAEAGVVHVIGTTGMNDAQIAQLEPASRQSVQMRAGNMSLGVN 137

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V L+D    
Sbjct: 138 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVTLSDVSDS 195

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG +++R G IVGEH V+ AG+GE I L H A DR IFARG++ AAL
Sbjct: 196 GRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAGQGERIVLRHLATDRAIFARGAIKAAL 255

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 256 WGQGKEPGQYDMLDVLGL 273


>gi|259417710|ref|ZP_05741629.1| dihydrodipicolinate reductase [Silicibacter sp. TrichCH4B]
 gi|259346616|gb|EEW58430.1| dihydrodipicolinate reductase [Silicibacter sp. TrichCH4B]
          Length = 269

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 110/258 (42%), Positives = 153/258 (59%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK +  +    L  ++ R G   +GQD+G  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLIKTVLESDKAELAGVVEREGHDWVGQDIGIAMGGAALGVAVTDDALAAFSEAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  T+    ++AQ   VH+IGTTG S  +   +   AR+  +V++ NMSLG+N
Sbjct: 74  AVIDFTAPEATIAFSKLAAQAGCVHVIGTTGMSDAQIAALDPAARDTVLVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +++D E++E HH  K+D+PSGTAL+LGEA A GR V L D    
Sbjct: 134 LLVQLTKKVAAAL--DEEFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVKLADVADR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR +G IG  ++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 192 GRDGITGARKKGDIGFTAIRGGDIVGEHDVLFAAAGERIVLRHMATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + +  G Y M DVLG+
Sbjct: 252 WGQGKAAGAYDMIDVLGL 269


>gi|71064609|ref|YP_263336.1| dihydrodipicolinate reductase [Psychrobacter arcticus 273-4]
 gi|90101255|sp|Q4FVQ6|DAPB_PSYA2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|71037594|gb|AAZ17902.1| dihydrodipicolinate reductase [Psychrobacter arcticus 273-4]
          Length = 278

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 164/267 (61%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           + + V+G GGRMG+ LI+ I +NP   L++ I R GS L+G D G    I  + ++  D+
Sbjct: 10  INVGVIGAGGRMGRMLIEAIQDNPQTALNAAIERQGSSLVGADAGEVAAIGRLEVQIVDD 69

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   I  +D +IDFS PA T Q++ + A+HN+  +IGTTGF+ ++ +V++  +    IV 
Sbjct: 70  LKAVINDIDVLIDFSLPAATEQNMQVCAKHNVAMVIGTTGFNEQQEQVLAKASEQVAIVY 129

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S G+N    L+  AA+      D D EI+E HH+ K+D+PSGTA ++ EA+A  R 
Sbjct: 130 AGNYSTGVNLSLKLLGMAAKAF--GTDADVEIIEAHHKHKIDAPSGTAYMMAEAVAEARG 187

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL + +V  R  Q  AR  G+IGI ++R G I+G+H+V+   +GE + ++H A  R  F
Sbjct: 188 QNLKEVVVYGREGQTGAREAGTIGIHAIRGGEIIGDHTVMFIADGEVVEITHRARARMTF 247

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W   Q  G Y+M+DVLG+
Sbjct: 248 AAGAVRAATWIVQQPVGQYNMQDVLGL 274


>gi|297184031|gb|ADI20151.1| dihydrodipicolinate reductase [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 269

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 162/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +++++G  GRMGQ LIK    +  + L  +  R+    IG+D+G  +G S  GI  SD+ 
Sbjct: 6   KVAIVGASGRMGQMLIKASLASDKVKLVGVTERNSHEWIGRDLGVCMGTSENGITVSDDP 65

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
               +  D +IDF++P  T++   ++A+  I H+IGTTG       ++ +FA+  PI+++
Sbjct: 66  LGIFKGADAVIDFTTPKATIEHARLAAESKIAHVIGTTGMDDSHLSLLETFAKKIPIIRA 125

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMSLG+N L  L +  +  L   +D+D EI+E HHR K+D+PSGTAL+LG A A GR V
Sbjct: 126 GNMSLGVNLLTLLTKKISTVL--DEDFDIEIVESHHRHKVDAPSGTALMLGHAAAEGRGV 183

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
            L +     R     ART G IG  ++R G +VGEH V+ A +GE I L H A DR+IF 
Sbjct: 184 KLLNVEDRGRDGITGARTRGDIGFHAIRGGDVVGEHDVIFAADGERIVLRHLATDRQIFV 243

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG+L AA+WA+ +  G Y M DVLG+
Sbjct: 244 RGALRAAIWAQDKDAGEYDMMDVLGL 269


>gi|83950712|ref|ZP_00959445.1| dihydrodipicolinate reductase [Roseovarius nubinhibens ISM]
 gi|83838611|gb|EAP77907.1| dihydrodipicolinate reductase [Roseovarius nubinhibens ISM]
          Length = 270

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L+K I  +    L   + R G   +GQD+G  +G +  G+  SD+    + + D
Sbjct: 14  GRMGQMLVKTIRESGRARLCGALERPGHDWVGQDLGRAMGGAESGVIVSDDALEVLATCD 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA T++   ++AQ  IVH+IGTTG + ++   + + A +A IV++ NMSLG+N
Sbjct: 74  AVIDFTAPAATVEFAALAAQARIVHVIGTTGMTEEDIAKVDAAAHHATIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L    A  L   +D+D E++E HH +K+D+PSGTAL+LG+A A GR V+L D    
Sbjct: 134 LLVQLTRKVAAAL--DEDFDIEVIEAHHNQKVDAPSGTALMLGQAAAEGRGVSLEDVSDR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG  ++R G IVGEH V+ A  GE I L H A DR IFARG++ AAL
Sbjct: 192 GRDGITGARKRGDIGFTAIRGGDIVGEHDVLFAAAGERIVLRHMATDRAIFARGAVKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG + M DVLG+
Sbjct: 252 WGVGRGPGHFDMMDVLGL 269


>gi|93004866|ref|YP_579303.1| dihydrodipicolinate reductase [Psychrobacter cryohalolentis K5]
 gi|92392544|gb|ABE73819.1| dihydrodipicolinate reductase [Psychrobacter cryohalolentis K5]
          Length = 276

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 162/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           + + V+G GGRMG+ LI+ I +NP  TL + I R GS L+G D G    +  + ++  D+
Sbjct: 10  INVGVIGAGGRMGRMLIEAIQDNPQTTLIAAIERQGSSLVGADAGEVAAVGRLNVQIVDD 69

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   I  +D +IDFS PA T Q++ + A+HN+  +IGTTGF+ ++ +V++  +    IV 
Sbjct: 70  LQSVINKIDVLIDFSLPAATEQNMQVCAEHNVAMVIGTTGFNEQQEQVLAKASEQVAIVY 129

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S G+N    L+  AA+      D D E++E HH+ K+D+PSGTA ++ EA+A  R 
Sbjct: 130 AGNYSTGVNLSLKLLGMAAKAF--GTDADVEVIEAHHKHKIDAPSGTAYMMAEAVAEARG 187

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  V  R  Q   R  G+IGI ++R G I+G+H+V+   +GE + ++H A  R  F
Sbjct: 188 QNLKDVAVYGREGQTGEREAGTIGIHAIRGGEIIGDHTVMFIADGEVVEITHRARARMTF 247

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W   Q  G Y+M+DVLG+
Sbjct: 248 AAGAVRAATWIVQQSAGQYNMQDVLGL 274


>gi|83941727|ref|ZP_00954189.1| dihydrodipicolinate reductase [Sulfitobacter sp. EE-36]
 gi|83847547|gb|EAP85422.1| dihydrodipicolinate reductase [Sulfitobacter sp. EE-36]
          Length = 271

 Score =  211 bits (537), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 111/271 (40%), Positives = 160/271 (59%), Gaps = 2/271 (0%)

Query: 1   MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60
           M  +P  +     GRMGQ LI ++  +  + L   + R+G   +GQD+G  +G + +G+ 
Sbjct: 1   MSDTPGIVITGASGRMGQMLIGQVSASDRVHLAGAVERAGHAWVGQDIGVAMGGTAVGVI 60

Query: 61  FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
            +DN A A+Q    +IDF++P  TL    I+A   +VH+IGTTG +  +   +   ++  
Sbjct: 61  VTDNAAKAMQDAQAVIDFTAPEATLAFAKIAADAGVVHVIGTTGMTDAQIGALDGPSKQT 120

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
            IV++ NMSLG+N L  L +  A  L   +D+D E++E HH +K+D+PSGTAL+LGEA A
Sbjct: 121 VIVRAGNMSLGVNLLTQLTKRVAAAL--DEDFDIEVIEAHHNQKVDAPSGTALMLGEAAA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V L D     R     AR  G IG  ++R G IVGEH V+ A  GE I L H A D
Sbjct: 179 EGRGVALADVSDRGRDGITGARKRGDIGFTAIRGGDIVGEHDVMFAAAGERIILRHIASD 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +FARG++ AA+W + +  G Y M DVLG+
Sbjct: 239 RAVFARGAIKAAVWGQGKPAGAYDMLDVLGL 269


>gi|163745465|ref|ZP_02152825.1| dihydrodipicolinate reductase [Oceanibulbus indolifex HEL-45]
 gi|161382283|gb|EDQ06692.1| dihydrodipicolinate reductase [Oceanibulbus indolifex HEL-45]
          Length = 272

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/273 (43%), Positives = 167/273 (61%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M ++P  I+V G  GRMGQ LI+EI ++  + L + + R+G   +G+D+G  +G +  G+
Sbjct: 1   MTKTP-GIAVTGASGRMGQMLIREITSSDKMHLAAAVERAGHDWVGRDIGEAMGGTASGV 59

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKE-NEVISSFAR 118
             +D+ A A   V  +IDF++P  T+     +A+  IVH+IGTTG S  E  ++  +  +
Sbjct: 60  TVTDDAAEAFAKVQAVIDFTAPQATIAFAAAAAKAGIVHVIGTTGMSDDEIAQLAPAAEQ 119

Query: 119 NAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEA 178
            A I+++ NMSLG+N L  L    A  L    D+D EI+E HH +K+D+PSGTAL+LGEA
Sbjct: 120 GAIIIRAGNMSLGVNLLTQLTRQVAAAL--DADYDIEIIESHHNQKVDAPSGTALMLGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
            A GR V L D     R     AR +G IG  ++R G IVGEH V+ A  GE I L H A
Sbjct: 178 AAEGRGVKLADVSDRGRDGITGAREKGDIGFTAIRGGDIVGEHDVMFAAAGERIILRHIA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            DR +FARG+L AALW + Q PG Y M DVLG+
Sbjct: 238 SDRALFARGALKAALWGQGQAPGEYDMLDVLGL 270


>gi|302185419|ref|ZP_07262092.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. syringae
           642]
          Length = 267

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 162/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + + R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAVDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLEEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W + + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLEGKAPGLYDMQDVLGL 266


>gi|163739810|ref|ZP_02147217.1| dihydrodipicolinate reductase [Phaeobacter gallaeciensis BS107]
 gi|161386844|gb|EDQ11206.1| dihydrodipicolinate reductase [Phaeobacter gallaeciensis BS107]
          Length = 273

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK I ++P   L   + R G   +GQDVG  +G S +GI  +D+   A     
Sbjct: 18  GRMGQMLIKTIADHPRAHLVGAVEREGHDWVGQDVGLAMGGSEIGITVTDDAPAAFAKAQ 77

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+SP  T+    ++A+  +VH+IGTTG +  +   +   +R++  +++ NMSLG+N
Sbjct: 78  AVIDFTSPEATIAFAGMAAEAGVVHVIGTTGMNDAQIVQLEPASRHSVQMRAGNMSLGVN 137

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V L+D    
Sbjct: 138 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVTLSDVSDS 195

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G IG +++R G IVGEH V+ AG+GE I L H A DR IFARG++ AAL
Sbjct: 196 GRDGITGARKRGDIGFSAIRGGDIVGEHDVLFAGQGERIVLRHLATDRAIFARGAIKAAL 255

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 256 WGQGKEPGQYDMLDVLGL 273


>gi|254285954|ref|ZP_04960915.1| dihydrodipicolinate reductase [Vibrio cholerae AM-19226]
 gi|150423864|gb|EDN15804.1| dihydrodipicolinate reductase [Vibrio cholerae AM-19226]
          Length = 269

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 62  LKQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDVLGL 266


>gi|289676011|ref|ZP_06496901.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. syringae
           FF5]
 gi|330981076|gb|EGH79179.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 267

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 161/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLEEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|126664877|ref|ZP_01735861.1| dihydrodipicolinate reductase [Marinobacter sp. ELB17]
 gi|126631203|gb|EBA01817.1| dihydrodipicolinate reductase [Marinobacter sp. ELB17]
          Length = 267

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 159/265 (60%), Gaps = 3/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+++++G  GRMG+ LI+ +     + L + IV  G+ LIG D G+  GI   G+  + +
Sbjct: 1   MKVAIIGAAGRMGKVLIEAVDGTDGLQLGAAIVEPGNSLIGADAGDMTGIGKTGVAMAGS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D +IDF+ P LTL++      H   H+IGTTG S  E + ++  A N P+V 
Sbjct: 61  LADVKDDFDVLIDFTFPDLTLENARFCLAHGKSHVIGTTGLSDAEKQQLAQVAENVPVVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N +  L+ TAA  L    D+D EI+E HHR K D+PSGTAL +GE +A+   
Sbjct: 121 APNMSVGVNVVLNLLRTAAAAL--GDDYDVEIIEAHHRHKKDAPSGTALRMGEVVADALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      RT   IG  ++RAG +VG+H+V+ A EGE I ++H A  R  F
Sbjct: 179 RDLKECAVYGREGFTGERTRKEIGFETIRAGDVVGDHTVLFATEGERIEITHKATSRMTF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AALW K +  GLY M+DVL
Sbjct: 239 AKGAMRAALWLKDKPAGLYDMQDVL 263


>gi|229507546|ref|ZP_04397051.1| dihydrodipicolinate reductase [Vibrio cholerae BX 330286]
 gi|229524378|ref|ZP_04413783.1| dihydrodipicolinate reductase [Vibrio cholerae bv. albensis VL426]
 gi|229528621|ref|ZP_04418011.1| dihydrodipicolinate reductase [Vibrio cholerae 12129(1)]
 gi|229332395|gb|EEN97881.1| dihydrodipicolinate reductase [Vibrio cholerae 12129(1)]
 gi|229337959|gb|EEO02976.1| dihydrodipicolinate reductase [Vibrio cholerae bv. albensis VL426]
 gi|229355051|gb|EEO19972.1| dihydrodipicolinate reductase [Vibrio cholerae BX 330286]
          Length = 276

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 9   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 68

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 69  LEQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 128

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 129 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 186

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 187 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 246

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 247 ANGAVKAAIWLAEQPAGFYTMTDVLGL 273


>gi|121591073|ref|ZP_01678385.1| dihydrodipicolinate reductase [Vibrio cholerae 2740-80]
 gi|121727491|ref|ZP_01680609.1| dihydrodipicolinate reductase [Vibrio cholerae V52]
 gi|147674435|ref|YP_001217894.1| dihydrodipicolinate reductase [Vibrio cholerae O395]
 gi|153802032|ref|ZP_01956618.1| dihydrodipicolinate reductase [Vibrio cholerae MZO-3]
 gi|153819992|ref|ZP_01972659.1| dihydrodipicolinate reductase [Vibrio cholerae NCTC 8457]
 gi|153828832|ref|ZP_01981499.1| dihydrodipicolinate reductase [Vibrio cholerae 623-39]
 gi|227082514|ref|YP_002811065.1| dihydrodipicolinate reductase [Vibrio cholerae M66-2]
 gi|254226143|ref|ZP_04919739.1| dihydrodipicolinate reductase [Vibrio cholerae V51]
 gi|262168375|ref|ZP_06036072.1| dihydrodipicolinate reductase [Vibrio cholerae RC27]
 gi|262189900|ref|ZP_06048221.1| dihydrodipicolinate reductase [Vibrio cholerae CT 5369-93]
 gi|297581019|ref|ZP_06942944.1| dihydrodipicolinate reductase [Vibrio cholerae RC385]
 gi|298500248|ref|ZP_07010053.1| dihydrodipicolinate reductase [Vibrio cholerae MAK 757]
 gi|172047589|sp|A5F5N9|DAPB_VIBC3 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|254767069|sp|C3LQT6|DAPB_VIBCM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|121547078|gb|EAX57214.1| dihydrodipicolinate reductase [Vibrio cholerae 2740-80]
 gi|121630159|gb|EAX62561.1| dihydrodipicolinate reductase [Vibrio cholerae V52]
 gi|124122442|gb|EAY41185.1| dihydrodipicolinate reductase [Vibrio cholerae MZO-3]
 gi|125621311|gb|EAZ49649.1| dihydrodipicolinate reductase [Vibrio cholerae V51]
 gi|126509470|gb|EAZ72064.1| dihydrodipicolinate reductase [Vibrio cholerae NCTC 8457]
 gi|146316318|gb|ABQ20857.1| dihydrodipicolinate reductase [Vibrio cholerae O395]
 gi|148875708|gb|EDL73843.1| dihydrodipicolinate reductase [Vibrio cholerae 623-39]
 gi|227010402|gb|ACP06614.1| dihydrodipicolinate reductase [Vibrio cholerae M66-2]
 gi|227014285|gb|ACP10495.1| dihydrodipicolinate reductase [Vibrio cholerae O395]
 gi|262023267|gb|EEY41971.1| dihydrodipicolinate reductase [Vibrio cholerae RC27]
 gi|262034217|gb|EEY52636.1| dihydrodipicolinate reductase [Vibrio cholerae CT 5369-93]
 gi|297534845|gb|EFH73681.1| dihydrodipicolinate reductase [Vibrio cholerae RC385]
 gi|297540941|gb|EFH76995.1| dihydrodipicolinate reductase [Vibrio cholerae MAK 757]
 gi|327484888|gb|AEA79295.1| Dihydrodipicolinate reductase [Vibrio cholerae LMA3894-4]
          Length = 269

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 62  LEQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDVLGL 266


>gi|82701611|ref|YP_411177.1| dihydrodipicolinate reductase [Nitrosospira multiformis ATCC 25196]
 gi|123545049|sp|Q2YBT6|DAPB_NITMU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|82409676|gb|ABB73785.1| dihydrodipicolinate reductase [Nitrosospira multiformis ATCC 25196]
          Length = 269

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 168/269 (62%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S + I+V G  GRMG+AL++ +   P + L + + RSGSP +G+D G  +G SP GI  +
Sbjct: 2   STLNIAVAGSSGRMGRALLEAVERAPDMRLSAALERSGSPYLGKDAGELIG-SPCGIGIT 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           DN+  A+     ++DF+ P  TL  ++   + NI  +IGTTGFS ++ E +   +R+  I
Sbjct: 61  DNVDTALDGSQVLVDFTRPDGTLVHVDRCREKNIKMVIGTTGFSPRQKEALWIASRDIAI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L+ETAA  L   +D+D EI+E HHR K+D+PSGTALL+GE +A  
Sbjct: 121 VLAPNMSVGVNVTLKLLETAARVL--NEDYDIEIIEAHHRHKVDAPSGTALLMGEVVAKA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
               L++  V +R      R  GSIG A++R G IVG+H+V+ AG GE I +SH A  R 
Sbjct: 179 LGKELSEVAVYSREGHTGEREAGSIGFATVRGGDIVGDHTVMFAGTGERIEISHKASSRA 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G+L AA +   +  G++ M+DVLG+
Sbjct: 239 TFAEGALRAARFLADKRNGMFDMQDVLGL 267


>gi|153217419|ref|ZP_01951170.1| dihydrodipicolinate reductase [Vibrio cholerae 1587]
 gi|124113568|gb|EAY32388.1| dihydrodipicolinate reductase [Vibrio cholerae 1587]
          Length = 269

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 62  LEQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDVLGL 266


>gi|330958062|gb|EGH58322.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 267

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 162/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + + R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAVDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI+E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEIIEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRETIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|229521223|ref|ZP_04410643.1| dihydrodipicolinate reductase [Vibrio cholerae TM 11079-80]
 gi|229341755|gb|EEO06757.1| dihydrodipicolinate reductase [Vibrio cholerae TM 11079-80]
          Length = 276

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 9   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 68

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D IIDF++PA TL +L +  QH+   +IGTTGF+  + + I   A+  PIV 
Sbjct: 69  LEQAVAQFDVIIDFTAPASTLANLALCEQHSKKLVIGTTGFTDAQRQAIEQAAKKIPIVM 128

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 129 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 186

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 187 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 246

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 247 ANGAVKAAIWLAEQPAGFYTMTDVLGL 273


>gi|289624589|ref|ZP_06457543.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289646948|ref|ZP_06478291.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330868233|gb|EGH02942.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 267

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 161/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEERQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSIGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|170719893|ref|YP_001747581.1| dihydrodipicolinate reductase [Pseudomonas putida W619]
 gi|229699951|sp|B1J256|DAPB_PSEPW RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|169757896|gb|ACA71212.1| Dihydrodipicolinate reductase [Pseudomonas putida W619]
          Length = 267

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 108/264 (40%), Positives = 162/264 (61%), Gaps = 3/264 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +       L + I R  S L+G D G    +  +G+  SD+L
Sbjct: 3   RIAVMGAAGRMGKTLIEAVQQTQGAGLTAAIDRPDSSLVGADAGELAALGRIGVLLSDDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +H    IIGTTGF+ +E ++++   ++ PIV +
Sbjct: 63  AKVADDFDVLIDFTHPSVTLKNLAFCRKHGKAMIIGTTGFTSEEKQLLAEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLSLKLLDMAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FA
Sbjct: 181 DLQEVAVYGREGQTGARDRQTIGFATVRAGDVVGDHTVLFAAEGERLEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVL 269
           +G++ AALW   +  GLY M+DVL
Sbjct: 241 KGAVRAALWLDGREAGLYDMQDVL 264


>gi|330877246|gb|EGH11395.1| dihydrodipicolinate reductase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963962|gb|EGH64222.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 267

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 161/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + + R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAVDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSIGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|146283643|ref|YP_001173796.1| dihydrodipicolinate reductase [Pseudomonas stutzeri A1501]
 gi|166222667|sp|A4VPQ3|DAPB_PSEU5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|33578042|gb|AAQ22348.1| dihydrodipicolinate reductase [Pseudomonas stutzeri A15]
 gi|145571848|gb|ABP80954.1| dihydrodipicolinate reductase [Pseudomonas stutzeri A1501]
          Length = 268

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSIT-LHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V G  GRMG+ LI+ +     +  L + I R  S L+G D G    I  +G+  + +
Sbjct: 3   RIAVTGAAGRMGKTLIEAVQQTGGVAGLTAAIDRPDSTLVGADAGELAAIGRLGVPLTGD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +A A+   D +IDF+ P++TL++L++  +     +IGTTGFS +E E +++ AR  PIV 
Sbjct: 63  VARAVDEFDVLIDFTHPSVTLKNLDVCRRAGKAMVIGTTGFSPEEKERLAAAAREIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++TAA  L    D D EI+E HHR K+D+PSGTAL +GE +A    
Sbjct: 123 AANFSVGVNLCLKLLDTAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVAEALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  F
Sbjct: 181 RDLQKVAVYGREGQTGARPRETIGFATVRAGDVVGDHTVLFAADGERVEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AALW   +  GLY M+DVLG+
Sbjct: 241 AKGAVRAALWLDEKPAGLYDMQDVLGL 267


>gi|15642388|ref|NP_232021.1| dihydrodipicolinate reductase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|153823332|ref|ZP_01975999.1| dihydrodipicolinate reductase [Vibrio cholerae B33]
 gi|254849514|ref|ZP_05238864.1| dihydrodipicolinate reductase [Vibrio cholerae MO10]
 gi|255746934|ref|ZP_05420879.1| dihydrodipicolinate reductase [Vibrio cholera CIRS 101]
 gi|262161523|ref|ZP_06030633.1| dihydrodipicolinate reductase [Vibrio cholerae INDRE 91/1]
 gi|14547975|sp|Q9KPH7|DAPB_VIBCH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|9656964|gb|AAF95534.1| dihydrodipicolinate reductase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|126519139|gb|EAZ76362.1| dihydrodipicolinate reductase [Vibrio cholerae B33]
 gi|254845219|gb|EET23633.1| dihydrodipicolinate reductase [Vibrio cholerae MO10]
 gi|255735336|gb|EET90736.1| dihydrodipicolinate reductase [Vibrio cholera CIRS 101]
 gi|262028834|gb|EEY47488.1| dihydrodipicolinate reductase [Vibrio cholerae INDRE 91/1]
          Length = 269

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 62  LEQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMIDVLGL 266


>gi|229512258|ref|ZP_04401737.1| dihydrodipicolinate reductase [Vibrio cholerae B33]
 gi|229519394|ref|ZP_04408837.1| dihydrodipicolinate reductase [Vibrio cholerae RC9]
 gi|229607052|ref|YP_002877700.1| dihydrodipicolinate reductase [Vibrio cholerae MJ-1236]
 gi|229344083|gb|EEO09058.1| dihydrodipicolinate reductase [Vibrio cholerae RC9]
 gi|229352223|gb|EEO17164.1| dihydrodipicolinate reductase [Vibrio cholerae B33]
 gi|229369707|gb|ACQ60130.1| dihydrodipicolinate reductase [Vibrio cholerae MJ-1236]
          Length = 276

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 9   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 68

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 69  LEQAVEQFDVIIDFTAPASTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 128

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 129 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 186

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 187 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 246

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 247 ANGAVKAAIWLAEQPAGFYTMIDVLGL 273


>gi|262170660|ref|ZP_06038338.1| dihydrodipicolinate reductase [Vibrio mimicus MB-451]
 gi|261891736|gb|EEY37722.1| dihydrodipicolinate reductase [Vibrio mimicus MB-451]
          Length = 269

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++P  TL +L +  Q+    +IGTTGFS  + + I   A+N PIV 
Sbjct: 62  LEQAVKQFDVIIDFTAPVSTLANLALCEQYGKKLVIGTTGFSDAQRQTIEQAAKNIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDVLGL 266


>gi|238755527|ref|ZP_04616866.1| Dihydrodipicolinate reductase [Yersinia ruckeri ATCC 29473]
 gi|238706283|gb|EEP98661.1| Dihydrodipicolinate reductase [Yersinia ruckeri ATCC 29473]
          Length = 273

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 168/273 (61%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R++++G GGRMG+ LI+ IH+   +TL + + R GS L+G D G   G+  + +
Sbjct: 1   MTDATIRVAIVGAGGRMGRQLIQAIHHIAGVTLSAALERKGSSLVGTDAGELAGVGRLNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K +D++   I S+D +IDF+ P  TL  L +  QH    +IGTTGF       I + A +
Sbjct: 61  KVTDDIVAVIDSIDVLIDFTRPEGTLAHLALCRQHGKAMVIGTTGFDDAGKAAIQAAATD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E A + +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNLVLKLLEKATKVM---GDYADIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R EG+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAETLGRDLKDCAVYSREGYTGERKEGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W  +Q  GL+ MRDVLG+
Sbjct: 238 TSRMTFANGAIKSAIWLSNQDKGLFDMRDVLGL 270


>gi|229514022|ref|ZP_04403484.1| dihydrodipicolinate reductase [Vibrio cholerae TMA 21]
 gi|229349203|gb|EEO14160.1| dihydrodipicolinate reductase [Vibrio cholerae TMA 21]
          Length = 276

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 112/267 (41%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 9   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 68

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++P  TL +L +  QH    +IGTTGF+  + + I   A+  PIV 
Sbjct: 69  LEQAVEQFDVIIDFTAPTSTLANLALCEQHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 128

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 129 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 186

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 187 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 246

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 247 ANGAVKAAIWLAEQPAGFYTMTDVLGL 273


>gi|158421781|ref|YP_001523073.1| dihydrodipicolinate reductase [Azorhizobium caulinodans ORS 571]
 gi|158328670|dbj|BAF86155.1| bacterial dihydrodipicolinate reductase [Azorhizobium caulinodans
           ORS 571]
          Length = 296

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 123/269 (45%), Positives = 162/269 (60%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +R+ + G GGRMGQ L++ + N   ++L   +  S S  +G+D G   G+ P G+   
Sbjct: 28  SDLRVVINGAGGRMGQELLRAVLNGEGLSLAGALEHSTSGHLGEDAGVLAGLKPAGVTIE 87

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            + A  +   D +IDFS+PA +++     A+  I  +IGTTGFS  EN  I + AR   +
Sbjct: 88  SDAAATLNGTDVVIDFSTPASSVRLAERLAEAGIAIVIGTTGFSAAENAAIEAAARRTVV 147

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           VKS NMSLG+N L     T         ++D EI+EMHH RK+D+PSGTALLLGEA A G
Sbjct: 148 VKSGNMSLGVNML--AALTRQAAAALGIEFDIEIVEMHHARKVDAPSGTALLLGEAAAEG 205

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R ++L D     R      R  G IG ASLR GS+VGEH+V+ AG  E + L H A  R 
Sbjct: 206 RGIHLPDWTAKARDGVTGPRRPGDIGFASLRGGSVVGEHAVIFAGPSERVELVHKAESRT 265

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           IFA G+LTAA WAK + PGLYSM DVLG+
Sbjct: 266 IFANGALTAARWAKGREPGLYSMVDVLGL 294


>gi|330937933|gb|EGH41720.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 267

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 160/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLEEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGGHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|163797067|ref|ZP_02191022.1| Dihydrodipicolinate reductase [alpha proteobacterium BAL199]
 gi|159177583|gb|EDP62136.1| Dihydrodipicolinate reductase [alpha proteobacterium BAL199]
          Length = 270

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 159/266 (59%), Gaps = 4/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI V G  GRMG+ ++K +     +TL +  VR+GS  +G D G   G+SP+G+  +D L
Sbjct: 4   RIGVFGANGRMGRMIVKAVAEADGVTLAAASVRAGSADLGTDAGVLAGLSPIGLSTTDRL 63

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
             A+ + D +IDF+ P  TL     +A      + GTTG S ++ + + + +   P+V +
Sbjct: 64  D-AVLATDVVIDFTLPDATLVHAAAAADAGTPFVTGTTGLSGEQEKTLETLSARIPLVYA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N L  LVE  A  L   + WD EI+EMHH RK+D+PSGTA+ LG A A GR  
Sbjct: 123 PNMSVGVNLLLALVERVAAAL--GEPWDIEIMEMHHNRKVDAPSGTAIGLGRAAAKGRGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +  D  VL+R      R  G IG A++R G ++GEH+VV AG  E I + H A  R IFA
Sbjct: 181 SFEDVAVLSREGHTGPRVPGQIGFATMRGGDVIGEHTVVFAGPAERIEIGHRAGGRHIFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
            G++TAA WA  + PG Y+M DVLG+
Sbjct: 241 NGAVTAARWAAGREPGFYTMLDVLGL 266


>gi|261211490|ref|ZP_05925778.1| dihydrodipicolinate reductase [Vibrio sp. RC341]
 gi|260839445|gb|EEX66071.1| dihydrodipicolinate reductase [Vibrio sp. RC341]
          Length = 269

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/267 (42%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G DVG   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDVGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +   H    +IGTTGFS  + + I   A+N PIV 
Sbjct: 62  LEQAVEQFDVIIDFTAPASTLANLALCELHGKKLVIGTTGFSDAQCQTIEQAAKNIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L++  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSNVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDVLGL 266


>gi|258620885|ref|ZP_05715919.1| dihydrodipicolinate reductase [Vibrio mimicus VM573]
 gi|258586273|gb|EEW10988.1| dihydrodipicolinate reductase [Vibrio mimicus VM573]
          Length = 269

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 112/267 (41%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++P  TL +L +  Q+    +IGTTGFS  + + I   ++N PIV 
Sbjct: 62  LEQAVKQFDVIIDFTAPVSTLANLALCEQYGKKLVIGTTGFSDAQRQTIEQASKNIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDVLGL 266


>gi|332559580|ref|ZP_08413902.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides WS8N]
 gi|332277292|gb|EGJ22607.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides WS8N]
          Length = 269

 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L+K +  +    L   + R GS  +G+D G  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLMKTVLASGKARLVGAVERPGSDWVGRDAGAAMGGAAIGVTVTDDPLAAFAQAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  T+Q   ++AQ   VH+IGTTG      E ++  A +A IV++ NMSLG+N
Sbjct: 74  AVIDFTAPEATMQFAELAAQARAVHVIGTTGLEPAHLERLAWAAHHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  AE L   +DWD E++E HHR K+D+PSGTAL+LGEA A GR V+L    V 
Sbjct: 134 LLTRLTQKVAEAL--DEDWDIEVVEAHHRMKVDAPSGTALMLGEAAARGRGVDLAQARVS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  GSIG +++R G IVGEH V+ A  GE ITL H A DR IFARG+L AAL
Sbjct: 192 GRDGITGPRAPGSIGFSAIRGGDIVGEHDVIFAAAGERITLRHVATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQDKRPGQYDMMDVLGL 269


>gi|257482274|ref|ZP_05636315.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|2833447|sp|Q52419|DAPB_PSESZ RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|1185002|gb|AAB41563.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tabaci]
 gi|320322541|gb|EFW78634.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320329990|gb|EFW85977.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330875236|gb|EGH09385.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|331011485|gb|EGH91541.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 267

 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 161/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +A+    
Sbjct: 123 ANFSIGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVASALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|298488443|ref|ZP_07006474.1| Dihydrodipicolinate reductase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157068|gb|EFH98157.1| Dihydrodipicolinate reductase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330987042|gb|EGH85145.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 267

 Score =  208 bits (529), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 161/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +A+    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVASALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|258623839|ref|ZP_05718793.1| dihydrodipicolinate reductase [Vibrio mimicus VM603]
 gi|258583828|gb|EEW08623.1| dihydrodipicolinate reductase [Vibrio mimicus VM603]
          Length = 269

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 112/267 (41%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++P  TL +L +  Q+    +IGTTGFS  + + I   A+N PIV 
Sbjct: 62  LEQAVKQFDVIIDFTAPVSTLANLALCEQYGKKLVIGTTGFSDAQRQTIEQAAKNIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M D LG+
Sbjct: 240 ANGAVKAAIWLAEQPAGFYTMTDALGL 266


>gi|170727912|ref|YP_001761938.1| dihydrodipicolinate reductase [Shewanella woodyi ATCC 51908]
 gi|259586139|sp|B1KRS8|DAPB_SHEWM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|169813259|gb|ACA87843.1| Dihydrodipicolinate reductase [Shewanella woodyi ATCC 51908]
          Length = 271

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 162/273 (59%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M    +R+++ GG GRMG+ LI+     P I L ++I R+GS LIG D G   G+  M +
Sbjct: 1   MMSEKVRVAITGGSGRMGRTLIEAARQQPMIYLGAVIERAGSTLIGVDAGELAGVGSMNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D+L +A+   D +IDF+SP  +L   +  A+H    +IGTTGF+  + E IS++A  
Sbjct: 61  PITDSLDLAVDDFDVLIDFTSPEASLVHTDWCAKHGKAIVIGTTGFNHSQKEQISAYAEK 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            P+V + NM++G+N L  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE 
Sbjct: 121 TPVVMAPNMAVGVNLLWKLLEVAAEVM---GDYTDIEIIEGHHRYKKDAPSGTALKMGEV 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L    V  R      R   +IG +++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAETLGRDLDKCAVYGREGITGERDRQTIGFSTIRAGDIVGEHTALFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA W   Q  GLY M+ VLG+
Sbjct: 238 SSRMTFANGAMRAASWLVEQDAGLYDMQQVLGL 270


>gi|192359909|ref|YP_001983147.1| dihydrodipicolinate reductase [Cellvibrio japonicus Ueda107]
 gi|190686074|gb|ACE83752.1| dihydrodipicolinate reductase [Cellvibrio japonicus Ueda107]
          Length = 275

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 159/266 (59%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI++ G  GRMG+ALI+  H NP   L + IVRSGS LIG D G    +  +G+    +L
Sbjct: 11  RIAIAGAAGRMGKALIESTHKNPDTALGAAIVRSGSSLIGADAGELGNVGKLGVAIVGSL 70

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDFSSP  TL +  + A HN   +IGTTGFSV E   + ++    P++ S
Sbjct: 71  AEVVDQFDVLIDFSSPLATLDNARVCAAHNKPVVIGTTGFSVAEKAELLAYQTQIPLLLS 130

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S G+N    L++ AA  L   + +D E+ E HHR K+DSPSGTA+ +GE +A   + 
Sbjct: 131 ANFSTGVNLCFKLLDLAARVL--GEGYDVEVYEAHHRHKVDSPSGTAVRMGEVLAKALER 188

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q   R   +IG A++R G +VG+H+V+   +GE + ++H A  R  F+
Sbjct: 189 DLDKVAVYGREGQIGPRPADTIGFATVRGGDVVGDHTVMFMADGERVEITHKASSRLAFS 248

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
            G++ AA+W + Q  GL+ M+DVLG+
Sbjct: 249 NGAVRAAIWLQQQTSGLFDMQDVLGL 274


>gi|254507844|ref|ZP_05119974.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus 16]
 gi|219549217|gb|EED26212.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus 16]
          Length = 269

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 162/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  + NP   + +   R  S L+G D+G   G     +  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKATYLNPQSEVGAGSERPESSLVGVDIGELCGEGKFDVFLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I+  D IIDF++P  TL +L +  QH    +IGTTGF+ +E E+I   A++ P+V 
Sbjct: 62  LAKDIERFDVIIDFTAPVSTLANLELCKQHGKSIVIGTTGFTEQEREIIDQIAQDVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   + PG Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLNGKQPGFYTMTDVLGL 266


>gi|99079928|ref|YP_612082.1| dihydrodipicolinate reductase [Ruegeria sp. TM1040]
 gi|122984485|sp|Q1GKJ6|DAPB_SILST RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|99036208|gb|ABF62820.1| dihydrodipicolinate reductase [Ruegeria sp. TM1040]
          Length = 269

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 155/258 (60%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK + ++    L  ++ R G   +GQD+G  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLIKTVLDSDKAELAGVVEREGHDWVGQDIGIAMGGAALGVVVTDDAGSAFAGAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  T+    ++A+   VH+IGTTG S  E   +   A++  +V++ NMSLG+N
Sbjct: 74  AVIDFTAPQATIAFSKLAAEAGCVHVIGTTGMSEAEIAQLDPAAQDTVLVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  A  L   +D+D E++E HH  K+D+PSGTAL+LGEA A GR V L +    
Sbjct: 134 LLVQLTKKVAAAL--DEDFDIEVIEAHHHHKVDAPSGTALMLGEAAAEGRGVALAEVSDR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR +G IG +++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 192 GRDGITGARKKGDIGFSAIRGGDIVGEHDVLFAAAGERIVLRHMATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + +  G Y M DVLG+
Sbjct: 252 WGQGKDAGAYDMIDVLGL 269


>gi|262404707|ref|ZP_06081262.1| dihydrodipicolinate reductase [Vibrio sp. RC586]
 gi|262349739|gb|EEY98877.1| dihydrodipicolinate reductase [Vibrio sp. RC586]
          Length = 269

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/267 (41%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP   L +   R  S L+G D+G   GI   GI   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKATHQNPLSELGAGSERPESSLVGVDIGELCGIGKQGIVLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D IIDF++PA TL +L +   H    +IGTTGF+  + + I   A+  PIV 
Sbjct: 62  LEQAVEQFDVIIDFTAPASTLANLALCELHGKKLVIGTTGFTDAQRQTIEQAAKKIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAQQPAGFYTMTDVLGL 266


>gi|77464687|ref|YP_354191.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides 2.4.1]
 gi|90101257|sp|Q3IYU4|DAPB_RHOS4 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|77389105|gb|ABA80290.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides 2.4.1]
          Length = 269

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L+K +  +    L   + R GS  +G+D G  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLMKTVLASGKARLVGAVERPGSDWVGRDAGAAMGGAAVGVTVTDDPLAAFAQAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  T+Q   ++AQ   VH+IGTTG      E ++  A +A IV++ NMSLG+N
Sbjct: 74  AVIDFTAPEATVQFAELAAQARAVHVIGTTGLEPAHLERLAWAAHHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  AE L   +DWD E++E HHR K+D+PSGTAL+LGEA A GR V+L    V 
Sbjct: 134 LLTRLTQKVAEAL--DEDWDIEVVEAHHRMKVDAPSGTALMLGEAAARGRGVDLAQARVS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  GSIG +++R G IVGEH V+ A  GE ITL H A DR IFARG+L AAL
Sbjct: 192 GRDGITGPRAPGSIGFSAIRGGDIVGEHDVIFAAAGERITLRHVATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQDRRPGQYDMMDVLGL 269


>gi|270263910|ref|ZP_06192178.1| dihydrodipicolinate reductase [Serratia odorifera 4Rx13]
 gi|270042103|gb|EFA15199.1| dihydrodipicolinate reductase [Serratia odorifera 4Rx13]
          Length = 273

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/273 (41%), Positives = 160/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI++ G GGRMG+ LI+ +H    + L + + R GS LIG D G   G+  +G+
Sbjct: 1   MTDSQIRIAIAGSGGRMGRQLIQAVHQAQGVVLGAAVSRPGSSLIGTDAGELAGVGSLGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L   +   D +IDF+ P  TL  L    +H    +IGTTGF     E I + A+ 
Sbjct: 61  TVSDSLEKVVDDFDILIDFTRPESTLAYLAFCVEHRKAMVIGTTGFDDAGKEAIRAAAQQ 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNLVLKLLEKAAQVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L +  V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALGRDLKECAVYAREGYTGERDPKSIGFATIRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA W  SQ  GL+ MRDVLG+
Sbjct: 238 SSRMTFAAGAVRAASWLHSQDKGLFDMRDVLGL 270


>gi|71734137|ref|YP_276324.1| dihydrodipicolinate reductase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|90101251|sp|Q48E64|DAPB_PSE14 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|71554690|gb|AAZ33901.1| dihydrodipicolinate reductase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 267

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 161/266 (60%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +   P   L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +A+    
Sbjct: 123 ANFSIGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVASALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDCQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|221640601|ref|YP_002526863.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides KD131]
 gi|254767056|sp|B9KP40|DAPB_RHOSK RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|221161382|gb|ACM02362.1| Dihydrodipicolinate reductase [Rhodobacter sphaeroides KD131]
          Length = 269

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L+K +  +    L   + R GS  +G+D G  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLMKTVLASGRARLVGAVERPGSDWVGRDAGAAMGGAAIGVTVTDDPLAAFAQAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  T+Q   ++AQ   VH+IGTTG      E ++  A +A IV++ NMSLG+N
Sbjct: 74  AVIDFTAPEATVQFAELAAQARAVHVIGTTGLEPAHLERLAWAAHHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  AE L   +DWD E++E HHR K+D+PSGTAL+LGEA A GR V+L    V 
Sbjct: 134 LLTRLTQKVAEAL--DEDWDIEVVEAHHRMKVDAPSGTALMLGEAAARGRGVDLAQARVS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  GSIG +++R G IVGEH V+ A  GE ITL H A DR IFARG+L AAL
Sbjct: 192 GRDGITGPRAPGSIGFSAIRGGDIVGEHDVIFAAAGERITLRHVATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQDRRPGQYDMMDVLGL 269


>gi|120556267|ref|YP_960618.1| dihydrodipicolinate reductase [Marinobacter aquaeolei VT8]
 gi|120326116|gb|ABM20431.1| dihydrodipicolinate reductase [Marinobacter aquaeolei VT8]
          Length = 267

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 161/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++++G  GRMG+ LI+ +     + L + IV  GS LIG D G   GI   G+K + +
Sbjct: 1   MRVAIIGAAGRMGKVLIEAVDGTEGLELGAAIVEPGSSLIGADAGEMTGIGKTGVKMAAS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D ++DF+ P LTL++    + +  + +IGTTG +  E E ++  A NAP+V 
Sbjct: 61  LDDVKDDFDVLVDFTFPDLTLENAKFCSANGKMLVIGTTGMTDAEKEQLALAAENAPVVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N +  L+ TAA  L    D+D EI+E HHR K D+PSGTAL +GE +A+   
Sbjct: 121 APNMSVGVNVVLNLLRTAAATL--GDDYDVEIIEAHHRHKKDAPSGTALRMGEVVADALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      RT   IG  ++RAG +VG+H+V+ A EGE I ++H A  R  F
Sbjct: 179 RDLKECAVYGREGFTGERTRKEIGFETIRAGDVVGDHTVLFATEGERIEITHKASSRMTF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AALW + +  GLY M+DVL +
Sbjct: 239 AKGAMRAALWLEGKAAGLYDMQDVLSL 265


>gi|126463527|ref|YP_001044641.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides ATCC 17029]
 gi|166224164|sp|A3PNF3|DAPB_RHOS1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|126105191|gb|ABN77869.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides ATCC 17029]
          Length = 269

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 158/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L+K +  +    L   + R GS  +G+D G  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLMKTVLASGKARLVGAVERPGSDWVGRDAGAAMGGAAIGVTVTDDPLAAFAQAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++P  T+Q   ++AQ   VH+IGTTG      E ++  A +A IV++ NMSLG+N
Sbjct: 74  AVIDFTAPEATVQFAELAAQARAVHVIGTTGLEPVHLERLAWAAHHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  AE L   +DWD E++E HHR K+D+PSGTAL+LGEA A GR V+L    V 
Sbjct: 134 LLTRLTQKVAEAL--DEDWDIEVVEAHHRMKVDAPSGTALMLGEAAARGRGVDLAQARVS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  GSIG +++R G IVGEH V+ A  GE ITL H A DR IFARG+L AAL
Sbjct: 192 GRDGITGPRAPGSIGFSAIRGGDIVGEHDVIFAAAGERITLRHVATDRAIFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQDKRPGQYDMMDVLGL 269


>gi|156973230|ref|YP_001444137.1| dihydrodipicolinate reductase [Vibrio harveyi ATCC BAA-1116]
 gi|166224186|sp|A7MXR0|DAPB_VIBHB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|156524824|gb|ABU69910.1| hypothetical protein VIBHAR_00911 [Vibrio harveyi ATCC BAA-1116]
          Length = 269

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/267 (41%), Positives = 161/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP  ++ +   R  S L+G DVG   G     +  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKASHLNPEASVTAGSERPESSLVGVDVGELCGEGKFDVFLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   + + D +IDF++P  TL +L +  QH    IIGTTGFS +E E+I   A+  P+V 
Sbjct: 62  LTKEVDNFDVVIDFTAPVSTLANLELCKQHGKSIIIGTTGFSEEERELIDEAAKQVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W  S+  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLHSKPAGFYTMTDVLGL 266


>gi|323491020|ref|ZP_08096212.1| dihydrodipicolinate reductase [Vibrio brasiliensis LMG 20546]
 gi|323314684|gb|EGA67756.1| dihydrodipicolinate reductase [Vibrio brasiliensis LMG 20546]
          Length = 269

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 111/267 (41%), Positives = 162/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+V G  GRMG+ L+K  +NN + ++ +   R  S L+G D+G   G     +  +D+
Sbjct: 2   VRIAVAGAAGRMGRNLVKATYNNENASVAAGSERPESSLVGVDLGELCGEGKFDVVVTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I+  D IIDF++P  TL +L +  QH    +IGTTGFS +E   I S A+  P+V 
Sbjct: 62  LAKDIEQFDVIIDFTAPVSTLANLELCRQHGKSIVIGTTGFSDEERAQIDSIAKEVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIADAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLNDVAVYAREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W K +  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLKEKPAGFYTMTDVLGL 266


>gi|259907378|ref|YP_002647734.1| dihydrodipicolinate reductase [Erwinia pyrifoliae Ep1/96]
 gi|224963000|emb|CAX54483.1| Dihydrodipicolinate reductase [Erwinia pyrifoliae Ep1/96]
 gi|283477210|emb|CAY73117.1| dapB [Erwinia pyrifoliae DSM 12163]
          Length = 273

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/272 (41%), Positives = 158/272 (58%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +RI+++G  GRMG+ LI+         L + +VRSGS L+G D G   G   +GI
Sbjct: 1   MSNAEIRIAIVGAAGRMGRQLIQATKQAEGARLGAALVRSGSSLVGTDAGELAGCGALGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +DNL   +   D +IDF+ P  TL  L    QH    +IGTTGF       I + A+ 
Sbjct: 61  TITDNLEAVVNDFDVLIDFTRPQATLHYLAFCRQHQKTMVIGTTGFDDAGKAAIGAAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  LVE AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNLVLKLVEKAAKVM--GEYADIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L  H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 ASAMNWDLEQHAVYAREGFTGEREAQTIGFATVRAGDIVGEHTAMFADIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR  FA+G++ AA W  S  PGLY MRDVL +
Sbjct: 239 DRMTFAKGAVWAAKWLGSNKPGLYDMRDVLNL 270


>gi|83855205|ref|ZP_00948735.1| dihydrodipicolinate reductase [Sulfitobacter sp. NAS-14.1]
 gi|83843048|gb|EAP82215.1| dihydrodipicolinate reductase [Sulfitobacter sp. NAS-14.1]
          Length = 256

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 154/256 (60%), Gaps = 2/256 (0%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MGQ LI ++  +  + L   + R+G   +GQD+G  +G + +G+  +DN A A+Q    +
Sbjct: 1   MGQMLIGQVSASDRVHLAGAVERAGHAWVGQDIGVAMGGTAVGVIVTDNAAEAMQGAQAV 60

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF++P  TL    I+A   +VH+IGTTG +  +   +   A+   IV++ NMSLG+N L
Sbjct: 61  IDFTAPEATLAFAKIAADAGVVHVIGTTGMTDAQIGELDGPAKQTVIVRAGNMSLGVNLL 120

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L +  A  L   +D+D E++E HH +K+D+PSGTAL+LGEA A GR V L D     R
Sbjct: 121 TQLTKRVAAAL--DEDFDIEVIEAHHNQKVDAPSGTALMLGEAAAEGRGVALADVSDRGR 178

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                AR  G IG  ++R G IVGEH V+ A  GE I L H A DR +FARG++ AA+W 
Sbjct: 179 DGITGARKRGDIGFTAIRGGDIVGEHDVMFAAAGERIILRHIASDRAVFARGAIKAAVWG 238

Query: 256 KSQIPGLYSMRDVLGI 271
           + +  G Y M DVLG+
Sbjct: 239 QGKPAGAYDMLDVLGL 254


>gi|83591494|ref|YP_425246.1| dihydrodipicolinate reductase [Rhodospirillum rubrum ATCC 11170]
 gi|83574408|gb|ABC20959.1| dihydrodipicolinate reductase [Rhodospirillum rubrum ATCC 11170]
          Length = 265

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 164/267 (61%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G  GRMG+ L+KE+  +P  TL   I R GSP  G D+G  +G   +GI   D+
Sbjct: 1   MKIGIVGCAGRMGRMLLKEVSASPETTLVGGIERPGSPATGTDLGLLIGSETIGIGVGDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
            A    + D +IDF++PA T+    ++A+H    I+GTTG        +   A+  P+V 
Sbjct: 61  AAELFAASDTVIDFTTPAATVTHAALAARHGSALIVGTTGMGPDHVAALERAAQKVPVVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+  L  L E  A  L    D+D EILEMHHR K+D+PSGTAL LG+A A GR 
Sbjct: 121 APNMSVGVTLLMALTERVAGLL--KDDYDIEILEMHHRFKVDAPSGTALGLGKAAAAGRG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           ++L +     R      R  GSIG A+LR G +VG+H+V+ A EGE I L+H A +R +F
Sbjct: 179 IDLDEMATRVRDGLTGPREPGSIGFATLRGGDVVGDHTVIFAAEGERIELTHRASNRAVF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L AALW + + PGLYSM DVLG+
Sbjct: 239 AKGALRAALWTRDRAPGLYSMHDVLGL 265


>gi|310765122|gb|ADP10072.1| dihydrodipicolinate reductase [Erwinia sp. Ejp617]
          Length = 273

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/272 (41%), Positives = 158/272 (58%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +RI+++G  GRMG+ LI+         L + +VRSGS L+G D G   G   +GI
Sbjct: 1   MSNAEIRIAIVGAAGRMGRQLIQATKQAGGARLGAALVRSGSSLVGTDAGELAGCGALGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +DNL   +   D +IDF+ P  TL  L    QH    +IGTTGF       I + A+ 
Sbjct: 61  TITDNLEAVVNDFDVLIDFTRPQATLHYLAFCRQHQKTMVIGTTGFDDAGKAAIGAAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  LVE AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNLVLKLVEKAAKVM--GEYADIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L  H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 ASAMNWDLEQHAVYAREGFTGEREAQTIGFATVRAGDIVGEHTAMFADIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR  FA+G++ AA W  S  PGLY MRDVL +
Sbjct: 239 DRMTFAKGAVRAAKWLGSNKPGLYDMRDVLNL 270


>gi|153834485|ref|ZP_01987152.1| dihydrodipicolinate reductase [Vibrio harveyi HY01]
 gi|269960250|ref|ZP_06174625.1| dihydrodipicolinate reductase [Vibrio harveyi 1DA3]
 gi|148869121|gb|EDL68157.1| dihydrodipicolinate reductase [Vibrio harveyi HY01]
 gi|269835057|gb|EEZ89141.1| dihydrodipicolinate reductase [Vibrio harveyi 1DA3]
          Length = 269

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 162/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP  ++ +   R  S L+G DVG   G     +  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKASHINPEASVTAGSERPESSLVGVDVGELCGEGKFDVFLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  + + D +IDF++P  TL +L +  QH    +IGTTGFS +E ++I   A+  P+V 
Sbjct: 62  LAKEVDNFDVVIDFTAPVSTLANLELCKQHGKSIVIGTTGFSEEERDLIDEAAKQIPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W  S+  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLHSKPAGFYTMTDVLGL 266


>gi|149912794|ref|ZP_01901328.1| dihydrodipicolinate reductase [Roseobacter sp. AzwK-3b]
 gi|149813200|gb|EDM73026.1| dihydrodipicolinate reductase [Roseobacter sp. AzwK-3b]
          Length = 272

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 113/258 (43%), Positives = 159/258 (61%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+ + ++P   L   + R+G   IG+D+G  +G +P+ +  +D+   A     
Sbjct: 14  GRMGQMLIRTVLDSPRAQLVGALERTGHDWIGRDLGEAMGGAPINLAVTDDPLEAFARAH 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA T++   I+AQ   VH+IGTTG S  +   I + AR+A I+++ NMSLG+N
Sbjct: 74  AVIDFTAPAATVEFAGIAAQARCVHVIGTTGLSDDDLAAIGAAARHATIIRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L    A  L   +D+D E++E HH +K+D+PSGTAL+LGEA A GR V L D    
Sbjct: 134 LLVQLTRKVAAAL--DEDFDIEVIEAHHNQKVDAPSGTALMLGEAAALGRGVRLDDVSDR 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  G IG +++R G IVGEH V+ A  GE + L H A DR +FARG+L AAL
Sbjct: 192 GRDGITGKRRRGDIGFSAIRGGDIVGEHDVMFAATGERVILRHIATDRAVFARGALKAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQGRKPGEYDMMDVLGL 269


>gi|269103421|ref|ZP_06156118.1| dihydrodipicolinate reductase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163319|gb|EEZ41815.1| dihydrodipicolinate reductase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 268

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 163/268 (60%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G GGRMG+ LIK      S TL   + R+GS L+G D G   G+  + I+  D+
Sbjct: 2   VRIAIAGAGGRMGRQLIKATTLVDSATLGVAVERTGSTLVGVDAGELAGVGLLNIQVIDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  +   D +IDF++P+ TL +L +   H    +IGTTGF+ +E   I   A++ P+V 
Sbjct: 62  LAAQMDQFDVLIDFTAPSATLANLELCKAHQKAIVIGTTGFTEQERASIDQAAQSIPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTA+ +GEAIA   
Sbjct: 122 APNYSVGVNLMFKLLEQAAKVM---GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAGAM 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
              L+D  V  R      R +  IG A++RAG IVGEH+ + A  GE I ++H A DR  
Sbjct: 179 DKKLSDVAVYAREGITGERKQSEIGFATIRAGDIVGEHTALFADIGERIEITHKASDRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA+W   Q  G Y+M+DVLG+
Sbjct: 239 FANGAVRAAIWLVEQKTGFYTMQDVLGL 266


>gi|284006378|emb|CBA71614.1| dihydrodipicolinate reductase [Arsenophonus nasoniae]
          Length = 273

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 110/270 (40%), Positives = 163/270 (60%), Gaps = 3/270 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +R++++G GGRMG+ LIK +     +TL +++ R GS ++G D G  VGI  + +
Sbjct: 1   MTNSDIRVAIVGAGGRMGRELIKAVSQQDGVTLGAVLERKGSSIVGTDAGELVGIGRLNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L   +   D +IDF+ P  T   L++  ++    IIGTTGF+  E + I   A+ 
Sbjct: 61  IVSDDLINVLDKFDILIDFTRPEGTQYYLSVCKKYAKAMIIGTTGFNETERKSIDETAKT 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA+ +   +  D EI+E HHR K+D+PSGTAL +G+ I
Sbjct: 121 IPIVLAANFSVGVNLVLKLLEKAAKVM--GEYSDIEIIEAHHRHKVDAPSGTALAMGDVI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L +  V +R      R   SIG A++RAG IVGEH+ + A  GE I ++H A 
Sbjct: 179 AKTIGRDLKNCAVYSRQGITGERENNSIGFATIRAGDIVGEHTAIFADIGERIEITHKAT 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
            R  FA G++ A LW K +  GLYSM+DVL
Sbjct: 239 SRMTFANGAVKACLWLKGKNSGLYSMKDVL 268


>gi|148651858|ref|YP_001278951.1| dihydrodipicolinate reductase [Psychrobacter sp. PRwf-1]
 gi|148570942|gb|ABQ93001.1| dihydrodipicolinate reductase [Psychrobacter sp. PRwf-1]
          Length = 275

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 162/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +++ V+G GGRMG+ LI+ +HNN +  L + I RSGS LIG D G  +G     +  SD+
Sbjct: 9   IKVGVIGAGGRMGRMLIEAVHNNANTVLAAAIERSGSSLIGVDAGELIGQHKNQVALSDD 68

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  + ++D +IDFS P  T +++ + A+H +  +IGTTG S  +  ++++ +   P+V 
Sbjct: 69  LAAELGNIDVLIDFSLPDATEKNVQLCAKHKVAMVIGTTGLSEAQEAMLNAASAQIPVVY 128

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S G+N    L+E AA+        D E++E HH+ K+D+PSGTA ++  A A  R 
Sbjct: 129 AGNYSTGVNVSLKLIEMAAKAF--GDSADIEVIESHHKHKVDAPSGTAFMMANAAATARG 186

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R  Q   R  GSIGI ++R G I+G+HSV++  +GE + + H A +R  F
Sbjct: 187 QDLKQVAVYGREGQTGERKPGSIGIHAIRGGEIIGDHSVMLIADGEMVEIKHHARERMTF 246

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W  +Q PG Y M+DVLG+
Sbjct: 247 AAGAVRAATWVVAQAPGRYDMQDVLGL 273


>gi|91226827|ref|ZP_01261480.1| dihydrodipicolinate reductase [Vibrio alginolyticus 12G01]
 gi|269967376|ref|ZP_06181436.1| dihydrodipicolinate reductase [Vibrio alginolyticus 40B]
 gi|91188958|gb|EAS75242.1| dihydrodipicolinate reductase [Vibrio alginolyticus 12G01]
 gi|269827964|gb|EEZ82238.1| dihydrodipicolinate reductase [Vibrio alginolyticus 40B]
          Length = 269

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP  T+ +   R  S L+G D+G   G     +  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKASHLNPEATVSAGSERPESSLVGVDIGELCGEGKFDVFLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  + + D IIDF++P  TL +L +  +H    +IGTTGFS  E E+I   A+  P+V 
Sbjct: 62  LAKDVDNFDVIIDFTAPVSTLANLELCKKHGKSIVIGTTGFSDAERELIDEAAKQVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLNDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W  ++  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLSAKPAGFYTMTDVLGL 266


>gi|304311950|ref|YP_003811548.1| Dihydrodipicolinate reductase [gamma proteobacterium HdN1]
 gi|301797683|emb|CBL45905.1| Dihydrodipicolinate reductase [gamma proteobacterium HdN1]
          Length = 288

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 157/267 (58%), Gaps = 3/267 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + +R++V+G  GRMG+A ++ +H    I L + I R GS L+G DVG   GI   G+   
Sbjct: 21  NAIRVAVVGAAGRMGRAHVQAVHETDGIALTAAIERPGSSLVGADVGEVAGIGKCGVAIV 80

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D L       D +IDF+SP  T+ +    A H     IGTTG S ++ + ++  A +  I
Sbjct: 81  DQLVAVKDQFDVLIDFTSPEATIANAQFCAAHGKKMAIGTTGLSAEQKQQLAECAASTAI 140

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L+E AA+ L    D D EI+E HHR K+D+PSGTAL +GE +A+ 
Sbjct: 141 VFAPNMSVGVNLCFKLLEIAAKVL--GDDVDIEIVEAHHRHKVDAPSGTALRMGEVVADA 198

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R  +  AR   +IG  ++RAG IVGEH+V+   +GE + ++H A  R 
Sbjct: 199 LGRDLREVAVYGREGRTGARDRKTIGFETIRAGDIVGEHTVMFCADGERVEVTHKATSRM 258

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVL 269
            FARG++ A LW  +Q  GLY M+DVL
Sbjct: 259 NFARGAVRACLWLATQERGLYDMQDVL 285


>gi|92115202|ref|YP_575130.1| dihydrodipicolinate reductase [Chromohalobacter salexigens DSM
           3043]
 gi|122419126|sp|Q1QSX7|DAPB_CHRSD RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|91798292|gb|ABE60431.1| dihydrodipicolinate reductase [Chromohalobacter salexigens DSM
           3043]
          Length = 269

 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 162/267 (60%), Gaps = 4/267 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+++G  GRMG+ L+  +  +P  +L   IV  GS L+G D+G   G+  +G+  +D+ 
Sbjct: 3   RIAIVGVAGRMGRTLVNAVQQDPEASLGGGIVEPGSSLVGADLGELAGVGRLGVNATDDP 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A    + D +IDF++P +TL +L   A+H    +IGTTG S  E   +  +    P+V +
Sbjct: 63  AAIADAFDVLIDFTAPRVTLANLAFCAEHGKAIVIGTTGLSDDELAELDGYRERVPMVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N    L+ETAA  L   + +D E+ E HHR K+D+PSGTAL +GE +A     
Sbjct: 123 PNMSVGVNLTLKLLETAARAL-GDEGYDIEVSEAHHRHKVDAPSGTALKMGEVVAKALSR 181

Query: 186 NLTDHMVLNRHIQQCA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           +L +  V  R + QC  R +  IG A++RAG IVGEH+V+ A EGE I ++H A  R  F
Sbjct: 182 DLKEDGVFER-VGQCGPRGDKEIGFATVRAGDIVGEHTVMFATEGERIEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W  S+  G Y M+DVLG+
Sbjct: 241 AKGAVRAARWVASRGNGRYDMQDVLGL 267


>gi|149375768|ref|ZP_01893536.1| dihydrodipicolinate reductase [Marinobacter algicola DG893]
 gi|149359893|gb|EDM48349.1| dihydrodipicolinate reductase [Marinobacter algicola DG893]
          Length = 267

 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 158/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++++G  GRMG+ LI+ +     + L + +V  GS LIG D G    I   G+K + +
Sbjct: 2   MRVAIIGAAGRMGKVLIEAVDGTEGLELGAAVVEPGSSLIGADAGEMTSIGKTGVKMAGS 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D +IDF+ P LTL++         + +IGTTG +  E E ++  A  AP+V 
Sbjct: 62  LADVKDDFDVLIDFTFPDLTLENAEFCKASGKMIVIGTTGLTDAEKEQLAVAAEKAPVVF 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+ TAA  L    D+D EI+E HHR K D+PSGTAL +GE +A+   
Sbjct: 122 APNMSVGVNVTLNLLRTAAAAL--GDDYDVEIIEAHHRHKKDAPSGTALRMGEVVADALG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      RT   IG  ++RAG +VG+H+V+ A EGE I ++H A  R  F
Sbjct: 180 RDLKECAVYGREGFTGERTRKEIGFETIRAGDVVGDHTVLFATEGERIEITHKASSRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AALW + +  GLY M+DVLG+
Sbjct: 240 AKGAMRAALWLEGKPAGLYDMQDVLGL 266


>gi|257455141|ref|ZP_05620379.1| dihydrodipicolinate reductase [Enhydrobacter aerosaccus SK60]
 gi|257447474|gb|EEV22479.1| dihydrodipicolinate reductase [Enhydrobacter aerosaccus SK60]
          Length = 268

 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 157/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I V+G GGRMG+ LI+ +  NP  TL   I R GS L+G D G  V +    +   D+
Sbjct: 2   VKIGVIGAGGRMGRMLIQAVAQNPQTTLAGAIERQGSSLLGVDAGELVNLDKTNVALVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I  +D +IDFS P  T ++L + A   +  +IGTTG + ++N ++   +    IV 
Sbjct: 62  LAGVIHDIDVLIDFSLPESTAKNLQLCADKGVNMVIGTTGLNDEQNAILKQASEKIAIVY 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S G+N    L+E AA+        D EI+E HH+ K+D+PSGTA ++ EA+A GR 
Sbjct: 122 AGNYSTGVNLTLKLLEMAAKAF--GDSADVEIIEAHHKHKIDAPSGTAYMMAEAVAKGRG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  +  R  Q  AR  G IGI ++R G IVG+H+V+   +GE + ++H A +R  F
Sbjct: 180 QNLKDVAIYGREGQTGARKAGEIGIHAIRGGEIVGDHTVMFIADGEIVEITHKARERMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  G + M+DVLG+
Sbjct: 240 AAGAVRAAVWVNEQQTGQFDMQDVLGL 266


>gi|288962153|ref|YP_003452448.1| dihydrodipicolinate reductase [Azospirillum sp. B510]
 gi|288914419|dbj|BAI75904.1| dihydrodipicolinate reductase [Azospirillum sp. B510]
          Length = 265

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 169/267 (63%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I V+G  GRMGQ L++EI      T+     R G P +G+D+G   GI P+G+   D+
Sbjct: 1   MKIGVVGCAGRMGQMLLREIAATAGCTVAGGTERVGGPALGRDLGVLAGIDPLGVTAIDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                   D +IDF+SP  T +   ++AQ   V +IGTTG +  +   I++ A +  IV+
Sbjct: 61  PVALFAEADAVIDFTSPDATERHAALAAQSETVLVIGTTGLNPSQQAAIATAATHTAIVQ 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+N L  LVE  A  L    D+D +ILEMHHRRK+D+PSGTAL LG A A GR 
Sbjct: 121 SPNMSLGVNLLLALVEQVAHAL--GDDFDIDILEMHHRRKVDAPSGTALGLGHAAAAGRG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D     R     AR +G IG A+LR G ++G+H+V+ AG+GE I L+H A  R+I+
Sbjct: 179 VALEDVWRKVRDGHTGARPQGEIGFATLRGGDVIGDHTVMFAGDGERIELTHKASGRQIY 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AALWA+ + PGLYSMR+VLG+
Sbjct: 239 AKGAVRAALWAQDKTPGLYSMRNVLGL 265


>gi|332976315|gb|EGK13172.1| dihydrodipicolinate reductase [Psychrobacter sp. 1501(2011)]
          Length = 277

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 153/259 (59%), Gaps = 2/259 (0%)

Query: 13  GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSV 72
           GGRMG+ LI+ + NNP  TL + I RS S L+G D G  VG+   G+  +DNL   +  +
Sbjct: 20  GGRMGRMLIEAVANNPQTTLAAAIERSSSSLVGVDAGELVGLEKNGVALNDNLQAELSKI 79

Query: 73  DGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGI 132
           D +IDFS P  T +++ + A + +  +IGTTG S  + E +++     P+V + N S G+
Sbjct: 80  DVLIDFSLPDSTEKNVQLCAANKVAMVIGTTGLSDAQEEALNAACEQIPVVYAGNYSTGV 139

Query: 133 NFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMV 192
           N    L+E AA+     +  D E++E HH+ K+D+PSGTA ++  A A  R  NL +  V
Sbjct: 140 NVSLKLIEMAAKAF--GETADIEVIESHHKHKVDAPSGTAFMMANAAAEARGQNLKEVAV 197

Query: 193 LNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAA 252
             R      R  GSIGI ++R G I+G+HSV++  +GE + + H A +R  FA G++ AA
Sbjct: 198 YGREGHTGERKPGSIGIHAIRGGEIIGDHSVMLIADGEMVEIKHHARERMTFAAGAVRAA 257

Query: 253 LWAKSQIPGLYSMRDVLGI 271
            W   Q PG Y M+DVLG+
Sbjct: 258 TWVIDQAPGRYDMQDVLGL 276


>gi|261253798|ref|ZP_05946371.1| dihydrodipicolinate reductase [Vibrio orientalis CIP 102891]
 gi|260937189|gb|EEX93178.1| dihydrodipicolinate reductase [Vibrio orientalis CIP 102891]
          Length = 269

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+V G  GRMG+ L+K  +NN +  + +   R  S L+G D+G   G     +  +D+
Sbjct: 2   VRIAVAGAAGRMGRNLVKATYNNENAAVAAGSERPESSLVGVDLGELCGEGKFDVVVTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I+  D IIDF++P  TL +L +  QH    +IGTTGFS +E   I   A+  P+V 
Sbjct: 62  LAKQIEQFDVIIDFTAPVSTLANLELCRQHGKSIVIGTTGFSDEERAKIDEIAKQVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NQLSDVAVYAREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W K +  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLKQKPAGFYTMTDVLGL 266


>gi|87120687|ref|ZP_01076580.1| dihydrodipicolinate reductase [Marinomonas sp. MED121]
 gi|86163915|gb|EAQ65187.1| dihydrodipicolinate reductase [Marinomonas sp. MED121]
          Length = 272

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/265 (38%), Positives = 158/265 (59%), Gaps = 3/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++++G  GRMG+ LI  +++     + + IV++GS L+G D G   G+  + +   D+
Sbjct: 7   MRVAIIGASGRMGKNLITAVNDAAGCVVGAAIVKTGSSLVGADAGEIAGVGKLNVAMVDS 66

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  +   D +IDF++PALT+++    A H    ++GTTG +  E   +   A    +V 
Sbjct: 67  LAACVNDFDVLIDFTTPALTIENARFCAAHQKAIVVGTTGLTEDEKAALDECATQTQVVF 126

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+ TAA+ L    ++D EI+E HHR K+DSPSGTA+ +GE +A    
Sbjct: 127 APNMSVGVNLTLKLLATAAKIL--GDEYDVEIVEAHHRHKVDSPSGTAIKMGEVVAEALG 184

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R  Q   RT+  IG  ++RAG +VG+HSV  A EGE I + H A  R  F
Sbjct: 185 RDLKECAVYGREGQIGPRTQKEIGFETIRAGDVVGDHSVWFATEGERIEIVHKASSRMTF 244

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AA W K +  G+Y M+DVL
Sbjct: 245 AKGAVRAAEWLKGKSAGMYDMQDVL 269


>gi|330888673|gb|EGH21334.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 267

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 159/266 (59%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +       L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQARGAGLPAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLVEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGT L +GE +AN    
Sbjct: 123 ANFSIGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTPLRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDVVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKAPGLYDMQDVLGL 266


>gi|260775358|ref|ZP_05884255.1| dihydrodipicolinate reductase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608539|gb|EEX34704.1| dihydrodipicolinate reductase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 269

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 164/267 (61%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  + N    + +   R  S L+G D+G   G     I  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKATYLNQQAQVGAGSERPESSLVGVDIGELCGEGKFDIVLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I++ D I+DF++P+ TL +L +  QH    IIGTTGF+ +E E I +FA++ P+V 
Sbjct: 62  LAKDIENFDVIVDFTAPSSTLANLELCKQHAKGIIIGTTGFTEQEREQIDAFAQHVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIADAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEVTHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 240 ANGAIKAAVWLNEKPAGFYTMTDVLGL 266


>gi|330447392|ref|ZP_08311041.1| dihydrodipicolinate reductase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491583|dbj|GAA05538.1| dihydrodipicolinate reductase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 269

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/268 (40%), Positives = 160/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K    +    L +   R+GS L+G D G   G     +   D+
Sbjct: 2   VRIAIAGAAGRMGRQLLKATQLSEKAELGAATERAGSTLVGVDAGELAGTGIADVIIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+ A+   D +IDF++P  TL ++    QHN   +IGTTGF+ +E E+I + A   P+V 
Sbjct: 62  LSKALDDFDVLIDFTAPVATLANIEFCKQHNKKIVIGTTGFTEQERELIDAAAAEIPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTA+ +GEAIA   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM---GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAM 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
              L+D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  
Sbjct: 179 GNKLSDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA+W   + PG Y+M DVLG+
Sbjct: 239 FANGAVRAAVWLNDKAPGFYTMEDVLGL 266


>gi|326794297|ref|YP_004312117.1| dihydrodipicolinate reductase [Marinomonas mediterranea MMB-1]
 gi|326545061|gb|ADZ90281.1| Dihydrodipicolinate reductase [Marinomonas mediterranea MMB-1]
          Length = 266

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI+++G  GRMG+ LI+       + L + +V+ GS L+G D G   G+  +GI   D+
Sbjct: 1   MRIAIIGASGRMGKNLIQATVEAEGVELGAALVKPGSSLVGADAGEIAGVGKLGIMLVDS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+SP+LT++++   + +N   +IGTTG + ++   +   A  APIV 
Sbjct: 61  IEACKDDFDVLIDFTSPSLTMENVAFCSSYNKAIVIGTTGLTDEQKNELECAANQAPIVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+ TAA+ L    D+D EI+E HHR K+DSPSGTAL +GE +A    
Sbjct: 121 APNMSVGVNLTLKLLATAAKIL--GDDYDVEIVEAHHRHKVDSPSGTALRMGEVVAEALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R  Q   RT+  IG  ++RAG +VG+HSV  A EGE I + H A  R  F
Sbjct: 179 RDLKECAVYGREGQIGPRTQKEIGFETIRAGDVVGDHSVWFATEGERIEIVHKASSRMTF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W   +  GLY M+DVL +
Sbjct: 239 AKGAVRAANWLSGKQNGLYDMQDVLNL 265


>gi|330895319|gb|EGH27657.1| dihydrodipicolinate reductase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 267

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 159/266 (59%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V+G  GRMG+ LI+ +       L + I R  S L+G D G    +  +G+  S +L
Sbjct: 3   RIAVVGAAGRMGKTLIEAVQQASGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF+ P++TL++L    +     IIGTTGFS +E + +    ++ PIV +
Sbjct: 63  AKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLEEAGKDIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    L++TAA  L    + D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 ANFSVGVNLCLKLLDTAARVL--GDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++RAG  VG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLEKVAVYGREGQTGARDRQTIGFATIRAGDGVGDHTVLFAADGERVEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W   + PGLY M+DVLG+
Sbjct: 241 KGAVRAAMWLDGKGPGLYDMQDVLGL 266


>gi|253988041|ref|YP_003039397.1| dihydrodipicolinate reductase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779491|emb|CAQ82652.1| dihydrodipicolinate reductase [Photorhabdus asymbiotica]
          Length = 273

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/274 (39%), Positives = 164/274 (59%), Gaps = 3/274 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R++++G GGRMG+ LI+ +H    + L   + RSGS L+G D G   GI  +G+
Sbjct: 1   MADTDIRVAIVGAGGRMGRQLIQAVHQLSGVVLGVALERSGSSLLGTDAGELAGIGHIGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+L   +   D +IDF+ P  TL  L I  +H+   +IGTTGF  +  + I   + N
Sbjct: 61  TVCDDLKNVVDDFDVLIDFTRPEGTLAHLEICRRHSKAIVIGTTGFDDEGKQAIKDASAN 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA+ +   +  D EI+E HHR K+D+PSGTAL +GE+I
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM--GEYTDIEIIEAHHRHKVDAPSGTALAMGESI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L +  V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 AHALGRDLKECAVYAREGYTGERDPKSIGFATIRAGDIVGEHTAMFADVGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGL 273
            R  FA G++ AALW   +  GL++M+DVL + L
Sbjct: 239 SRMTFANGAVKAALWLNGKNSGLFTMKDVLNLDL 272


>gi|148979735|ref|ZP_01815672.1| dihydrodipicolinate reductase [Vibrionales bacterium SWAT-3]
 gi|145961618|gb|EDK26917.1| dihydrodipicolinate reductase [Vibrionales bacterium SWAT-3]
          Length = 274

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 161/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H+N   ++ +   R  S L+G DVG   G     +   D+
Sbjct: 7   VRIAIAGAAGRMGRNLVKAAHHNSEASVGAGSERPESSLVGVDVGELCGEGRFDVALVDD 66

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+ AI+  D I+DF++P  TL ++ +  +H    IIGTTGFS +E +VI + A+  PIV 
Sbjct: 67  LSKAIEEFDVIVDFTAPVSTLANIELCKRHGKKLIIGTTGFSEEEKQVIDAAAKEMPIVM 126

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 127 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIFEAHHRHKVDAPSGTAIGMGEAIAGAMG 184

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V +R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 185 NELNDVAVWSREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 244

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 245 ANGAIKAAVWLNDKPAGFYTMTDVLGL 271


>gi|307546740|ref|YP_003899219.1| dihydrodipicolinate reductase [Halomonas elongata DSM 2581]
 gi|307218764|emb|CBV44034.1| dihydrodipicolinate reductase [Halomonas elongata DSM 2581]
          Length = 268

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 162/267 (60%), Gaps = 4/267 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI++ G  GRMG+ L+  +  +   TL    V  GS L+G D+G   G   +G+  +D+L
Sbjct: 3   RIAIAGVAGRMGRTLVNAVQQDAEATLAGGTVSPGSSLVGADIGELAGSGKLGVMATDSL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A      D +IDF++P +TL +L + A+H    +IGTTG S +E   + ++    P+V +
Sbjct: 63  AAIAADFDVLIDFTAPRVTLDNLAVCAEHGKRMVIGTTGLSDEELAELDAYRDRLPMVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N    L+ETAA  L   + +D E++E HHR K+D+PSGTAL LGE +A+    
Sbjct: 123 PNMSVGVNLTFKLLETAARAL-GDEGYDIEVIESHHRHKVDAPSGTALKLGEVVADALGR 181

Query: 186 NLTDHMVLNRHIQQCA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           +L    V  R + QC  R++  IG A++RAG IVGEH+V+ A EGE I ++H A  R  F
Sbjct: 182 DLKTDGVFER-VGQCGPRSDKEIGFATVRAGDIVGEHTVMFATEGERIEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W   Q  G Y M+DV+G+
Sbjct: 241 AKGAVRAARWVAGQPVGRYDMQDVIGL 267


>gi|37678807|ref|NP_933416.1| dihydrodipicolinate reductase [Vibrio vulnificus YJ016]
 gi|39930935|sp|Q7MNU2|DAPB_VIBVY RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|37197548|dbj|BAC93387.1| dihydrodipicolinate reductase [Vibrio vulnificus YJ016]
          Length = 269

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+V G  GRMG+ L+K  H+NP+  + +   R  S L+G D+G   G     +   D+
Sbjct: 2   VRIAVAGAAGRMGRNLVKAAHHNPAAKVAAGSERPESSLVGVDLGELCGECKFDVVVCDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I   D IIDF++PA TL +L +  Q+    +IGTTGF+ ++ E I   A+  P+V 
Sbjct: 62  LAKQIDQFDVIIDFTAPASTLNNLALCQQYGKSIVIGTTGFTEEQREQIDLVAQQVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLHEKPAGFYTMTDVLGL 266


>gi|77456992|ref|YP_346497.1| dihydrodipicolinate reductase [Pseudomonas fluorescens Pf0-1]
 gi|90101254|sp|Q3KI98|DAPB_PSEPF RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|77380995|gb|ABA72508.1| dihydrodipicolinate reductase [Pseudomonas fluorescens Pf0-1]
          Length = 268

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 162/267 (60%), Gaps = 4/267 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSIT-LHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+ L++ +     +T L + IVR GS LIG D G    +  +G+  S N
Sbjct: 3   RIAVMGAAGRMGKILVEAVQQRAPLTGLTAAIVRPGSTLIGVDAGELASLGRIGVPLSGN 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L    +  D +IDF+ P + L++L    +     +IGTTG    + ++++   ++ PIV 
Sbjct: 63  LESVAEEFDVLIDFTLPEVMLKNLAFCRKAGKAMVIGTTGLDAAQKQLLAEAGKDIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++ AA  L  A+D D EI+E HHR K+D+PSGTAL +GE IAN   
Sbjct: 123 AANFSVGVNLSLKLLDMAARVL--AEDADIEIIEAHHRHKIDAPSGTALRMGEVIANALD 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R     AR   +IG A++R G +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLQKVAVYGREGHTGARERETIGFATVRGGDVVGDHTVLFACEGERLEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AALW  ++ PGLY M+DVLG+
Sbjct: 241 AKGAVRAALWLDAREPGLYDMQDVLGL 267


>gi|14547953|sp|P58211|DAPB2_RHILO RecName: Full=Dihydrodipicolinate reductase 2; Short=DHPR 2
          Length = 258

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 119/273 (43%), Positives = 159/273 (58%), Gaps = 19/273 (6%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M Q P+RI++ G  GRMG+ +++ +  +P + L +   R  S      VG+ +      +
Sbjct: 1   MAQPPIRIAIAGALGRMGRQMVEAVQADPRLALAARFHRPDS------VGDGL------V 48

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHN-IVHIIGTTGFSVKENEVISSFAR 118
              + LAMA    D +IDF++PA +     +SA       +IG+TGF   E   I+  A+
Sbjct: 49  SRDEALAMA----DVVIDFTTPAASADLARVSANRGGPALVIGSTGFDAAELADIADAAK 104

Query: 119 NAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEA 178
             PIV+S + SLG+N L  LVE AA    P +DWD EI E HHR K+D+PSGTAL+LG+A
Sbjct: 105 TVPIVRSGSFSLGLNMLVGLVEQAARAFAP-EDWDAEIFEAHHRHKIDAPSGTALMLGQA 163

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           +A GR   L       R     AR  G IG A +R GSIVGEHSV    EGE +TLSH+A
Sbjct: 164 VAGGRGAELDAVARRVRDGVTGARPPGEIGFAVVRGGSIVGEHSVSFCAEGELVTLSHAA 223

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            DR +FARG++ AALW   + PG Y MRDVLG 
Sbjct: 224 GDRIMFARGAIAAALWVSGRPPGEYDMRDVLGF 256


>gi|238795186|ref|ZP_04638773.1| Dihydrodipicolinate reductase [Yersinia intermedia ATCC 29909]
 gi|238725473|gb|EEQ17040.1| Dihydrodipicolinate reductase [Yersinia intermedia ATCC 29909]
          Length = 273

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 164/273 (60%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I +   + L + + R GS L+G D G   G+  + I
Sbjct: 1   MTDSTIRIAVVGAGGRMGRQLIQAITHTEGVVLGAAVERVGSTLVGSDAGELAGVGLLNI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L+  +   D +IDF+ P  TL  L I  Q+    IIGTTGF     E I   A +
Sbjct: 61  TVSDDLSDVVDHFDVLIDFTRPEGTLAHLAICRQYRKAMIIGTTGFDDAGKEAIRVAATD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADSLGRSLKDCAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W  ++  GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAVWVSTRSNGLFDMRDVLNL 270


>gi|312884386|ref|ZP_07744092.1| dihydrodipicolinate reductase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367969|gb|EFP95515.1| dihydrodipicolinate reductase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 269

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 165/267 (61%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L++  ++NP+  + +   R  S LIG D+G   G   + +   D+
Sbjct: 2   VRIAIAGAAGRMGRNLVRATYSNPNAYVSAGSERPESSLIGVDLGELCGEGKLDVVVVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+  +   D I+DF+SP+ TL+++ +  +HN   +IGTTGFS +E  VI   A++ PIV 
Sbjct: 62  LSKNVNDFDVILDFTSPSSTLENIKLCQKHNKCIVIGTTGFSDEERMVIERSAKDVPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GHYSDIEIIEAHHRHKVDAPSGTAIGMGEAIASAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  R      RT+  IG A++RAG  +GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NSLNDVAVYAREGITGERTKDEIGFATIRAGDTIGEHTALFADIGEKVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W K + PG Y+M DVL +
Sbjct: 240 ANGAVRAAVWLKDKSPGFYTMVDVLSL 266


>gi|261346438|ref|ZP_05974082.1| dihydrodipicolinate reductase [Providencia rustigianii DSM 4541]
 gi|282565422|gb|EFB70957.1| dihydrodipicolinate reductase [Providencia rustigianii DSM 4541]
          Length = 273

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 162/271 (59%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +R++++G GGRMG+ LI+ +     + L + + R GS LIG D G   GI  +GI
Sbjct: 1   MADSMVRVAIVGAGGRMGRQLIQAVQEQEGVQLGAALEREGSSLIGTDAGELAGIGQIGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K    L   +   D +IDF+ P  TLQ L     H    +IGTTGF  +  + I+  A+ 
Sbjct: 61  KVVGGLDSVVDDFDVLIDFTRPEGTLQHLAFCKTHQKGMVIGTTGFDEQGKQAIADAAKV 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            PIV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE+
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGES 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L +  V  R      R  G+IG A++RAG IVGEH+ + A  GE + +SH A
Sbjct: 178 IADALGKDLNECAVYAREGYTGEREPGTIGFATVRAGDIVGEHTAMFADIGERVEISHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA+G++ A+ W  ++  GLY+M+DVL
Sbjct: 238 SSRMTFAKGAIKASSWVSAKNNGLYNMKDVL 268


>gi|328472008|gb|EGF42885.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus 10329]
          Length = 269

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 162/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP  ++ +   R  S L+G D+G   G     +  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKASHINPDASVTAGSERPESSLVGVDIGELCGEGMFDVFLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   + + D +IDF++P  TL +L +  QH    +IGTTGFS +E  +I + A++ P+V 
Sbjct: 62  LEKEVDNFDVVIDFTAPVSTLANLELCKQHGKSIVIGTTGFSEEERALIDAVAKHVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W  S+  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLHSKPAGFYTMTDVLGL 266


>gi|84393220|ref|ZP_00991982.1| dihydrodipicolinate reductase [Vibrio splendidus 12B01]
 gi|84376126|gb|EAP93012.1| dihydrodipicolinate reductase [Vibrio splendidus 12B01]
          Length = 274

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 162/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H N   ++ +   R  S L+G DVG   G     +   D+
Sbjct: 7   VRIAIAGAAGRMGRNLVKAAHQNSEASVGAGSERPESSLVGVDVGELCGEGRFDVALVDD 66

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+ AI+  D I+DF++P  TL ++ +  +H    IIGTTGFS +E +VI + ++  PIV 
Sbjct: 67  LSKAIEEFDVIVDFTAPVSTLANIELCKRHGKKLIIGTTGFSEEEKQVIDAASKEMPIVM 126

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 127 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 184

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V +R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 185 NDLNDVAVWSREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 244

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 245 ANGAIKAAVWLNDKPAGFYTMTDVLGL 271


>gi|260767325|ref|ZP_05876264.1| dihydrodipicolinate reductase [Vibrio furnissii CIP 102972]
 gi|260617648|gb|EEX42828.1| dihydrodipicolinate reductase [Vibrio furnissii CIP 102972]
 gi|315181121|gb|ADT88035.1| dihydrodipicolinate reductase [Vibrio furnissii NCTC 11218]
          Length = 269

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 111/267 (41%), Positives = 158/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H++P  T+ +   R  S L+G DVG   G     +   DN
Sbjct: 2   VRIAIAGAAGRMGRNLVKAAHHHPKATVGAGSERPESSLVGVDVGELCGEGRFDVALVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  AI   D IIDF++P  TL ++ +  +H    +IGTTGFS  E  +I   A+  PIV 
Sbjct: 62  LEQAIDQFDVIIDFTAPVSTLANIELCQKHGKKLVIGTTGFSDAERVLIDEAAKTMPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAHAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 240 ANGAVKAAIWLAEKPAGFYTMTDVLGL 266


>gi|89072558|ref|ZP_01159130.1| dihydrodipicolinate reductase [Photobacterium sp. SKA34]
 gi|89051662|gb|EAR57115.1| dihydrodipicolinate reductase [Photobacterium sp. SKA34]
          Length = 269

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 158/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K    +    L +   R+GS L+G D G   G     +   D+
Sbjct: 2   VRIAIAGAAGRMGRQLLKATQLSEKAELGAATERAGSTLVGVDAGELAGTGIANVIIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+ A+   D +IDF++P  TL ++    QHN   +IGTTGF+ +E E+I   AR+  IV 
Sbjct: 62  LSKALDDFDVLIDFTAPVATLANIKFCQQHNKKIVIGTTGFTEQERELIDLAARDISIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   + PG Y+M DVLG+
Sbjct: 240 ANGAVRAAVWLNDKSPGFYTMEDVLGL 266


>gi|320157412|ref|YP_004189791.1| dihydrodipicolinate reductase [Vibrio vulnificus MO6-24/O]
 gi|319932724|gb|ADV87588.1| dihydrodipicolinate reductase [Vibrio vulnificus MO6-24/O]
          Length = 269

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+V G  GRMG+ L+K  H+NP+  + +   R  S L+G D+G   G     +   D+
Sbjct: 2   VRIAVAGAAGRMGRNLVKAAHHNPAAKVAAGSERPESSLVGVDLGELCGEGKFDVVVCDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I   D IIDF++PA TL +L +  Q+    +IGTTGF+ ++ E I   A+  P+V 
Sbjct: 62  LAKQIDQFDVIIDFTAPASTLNNLALCQQYGKSIVIGTTGFTEEQREQIDLVAQQVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLHEKPAGFYTMTDVLGL 266


>gi|13476581|ref|NP_108151.1| dihydrodipicolinate reductase [Mesorhizobium loti MAFF303099]
 gi|14027343|dbj|BAB53612.1| dihydrodipicolinate reductase [Mesorhizobium loti MAFF303099]
          Length = 264

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 119/273 (43%), Positives = 159/273 (58%), Gaps = 19/273 (6%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M Q P+RI++ G  GRMG+ +++ +  +P + L +   R  S      VG+ +      +
Sbjct: 7   MAQPPIRIAIAGALGRMGRQMVEAVQADPRLALAARFHRPDS------VGDGL------V 54

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHN-IVHIIGTTGFSVKENEVISSFAR 118
              + LAMA    D +IDF++PA +     +SA       +IG+TGF   E   I+  A+
Sbjct: 55  SRDEALAMA----DVVIDFTTPAASADLARVSANRGGPALVIGSTGFDAAELADIADAAK 110

Query: 119 NAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEA 178
             PIV+S + SLG+N L  LVE AA    P +DWD EI E HHR K+D+PSGTAL+LG+A
Sbjct: 111 TVPIVRSGSFSLGLNMLVGLVEQAARAFAP-EDWDAEIFEAHHRHKIDAPSGTALMLGQA 169

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           +A GR   L       R     AR  G IG A +R GSIVGEHSV    EGE +TLSH+A
Sbjct: 170 VAGGRGAELDAVARRVRDGVTGARPPGEIGFAVVRGGSIVGEHSVSFCAEGELVTLSHAA 229

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            DR +FARG++ AALW   + PG Y MRDVLG 
Sbjct: 230 GDRIMFARGAIAAALWVSGRPPGEYDMRDVLGF 262


>gi|28897243|ref|NP_796848.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838416|ref|ZP_01991083.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus AQ3810]
 gi|260876210|ref|ZP_05888565.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus AN-5034]
 gi|260897164|ref|ZP_05905660.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus Peru-466]
 gi|260902209|ref|ZP_05910604.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus AQ4037]
 gi|34098485|sp|Q87SF5|DAPB_VIBPA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|28805452|dbj|BAC58732.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748179|gb|EDM59038.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus AQ3810]
 gi|308087989|gb|EFO37684.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus Peru-466]
 gi|308093046|gb|EFO42741.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus AN-5034]
 gi|308108467|gb|EFO46007.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus AQ4037]
          Length = 269

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 161/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP  ++ +   R  S L+G D+G   G     +  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKASHINPDASVTAGSERPESSLVGVDIGELCGEGKFDVFLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   + + D +IDF+ P  TL +L +  QH    +IGTTGFS +E  +I + A++ P+V 
Sbjct: 62  LEKEVDNFDVVIDFTVPVSTLANLELCKQHGKSIVIGTTGFSEEERALIDAVAKHVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W  S+  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLHSKPAGFYTMTDVLGL 266


>gi|152985176|ref|YP_001350801.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa PA7]
 gi|166222663|sp|A6VCL6|DAPB_PSEA7 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|150960334|gb|ABR82359.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa PA7]
          Length = 268

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 163/267 (61%), Gaps = 4/267 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSIT-LHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+ LI+ +        L + + R  S L+G D G   G+  +G+  S +
Sbjct: 3   RIAVVGAAGRMGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L    +  D +IDF+ P++TL+++    +     +IGTTGFS  E  +++  A++ PIV 
Sbjct: 63  LGKVCEEFDVLIDFTHPSVTLKNIEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++TAA  L    + D EI+E HHR K+D+PSGTAL +GE +A    
Sbjct: 123 AANFSVGVNLCLKLLDTAARVL--GDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLREVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALW + +  GLY M+DVLG+
Sbjct: 241 ARGAVRAALWLEGKESGLYDMQDVLGL 267


>gi|119775637|ref|YP_928377.1| dihydrodipicolinate reductase [Shewanella amazonensis SB2B]
 gi|166224170|sp|A1S8K1|DAPB_SHEAM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|119768137|gb|ABM00708.1| dihydrodipicolinate reductase [Shewanella amazonensis SB2B]
          Length = 270

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 159/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++V+G  GRMG+AL++   N+  I L + I R+GS L+G D G   GI  +G+   DN
Sbjct: 5   VRVAVIGASGRMGRALLEACDNHDGIVLGAAIERAGSTLVGVDAGEMAGIGHLGLALVDN 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+SP  TL +L   A+     +IGTTGF+  + E + +FA   P+V 
Sbjct: 65  LDAVADKFDVLIDFTSPEGTLANLEWCARQGKAIVIGTTGFNHAQKEQVVAFAEETPVVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AA+ +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWKLLELAAKVM---GDYTDIEIIEGHHRHKKDAPSGTALKMGEVIAQAL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLEKVAVYGREGITGERDRETIGFATIRAGDLVGEHTAMFADIGERLEITHKASSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 242 FANGAMRAAKWLAEQKPGLYDMQQVLGL 269


>gi|254229695|ref|ZP_04923105.1| dihydrodipicolinate reductase [Vibrio sp. Ex25]
 gi|262395250|ref|YP_003287104.1| dihydrodipicolinate reductase [Vibrio sp. Ex25]
 gi|151937816|gb|EDN56664.1| dihydrodipicolinate reductase [Vibrio sp. Ex25]
 gi|262338844|gb|ACY52639.1| dihydrodipicolinate reductase [Vibrio sp. Ex25]
          Length = 269

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H NP  T+ +   R  S L+G D+G   G     +  +D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKASHLNPEATVSAGSERPESSLVGVDIGELCGEGKFDVLLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  + + D IIDF++P  TL +L +  ++    +IGTTGFS  E ++I   A+  P+V 
Sbjct: 62  LAKDVDNFDVIIDFTAPVSTLANLELCKKYGKSIVIGTTGFSDAERDLIDEAAKQVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLNDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W  ++  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLSAKPAGFYTMTDVLGL 266


>gi|15599953|ref|NP_253447.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa PAO1]
 gi|116052906|ref|YP_793223.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893854|ref|YP_002442723.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa LESB58]
 gi|254238506|ref|ZP_04931829.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa C3719]
 gi|254244340|ref|ZP_04937662.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa 2192]
 gi|296391586|ref|ZP_06881061.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa PAb1]
 gi|313109740|ref|ZP_07795680.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa 39016]
 gi|12230904|sp|P38103|DAPB_PSEAE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|122257083|sp|Q02FR3|DAPB_PSEAB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226724144|sp|B7V1H1|DAPB_PSEA8 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|9951022|gb|AAG08145.1|AE004889_8 dihydrodipicolinate reductase [Pseudomonas aeruginosa PAO1]
 gi|115588127|gb|ABJ14142.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170437|gb|EAZ55948.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa C3719]
 gi|126197718|gb|EAZ61781.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa 2192]
 gi|218774082|emb|CAW29898.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa LESB58]
 gi|310882182|gb|EFQ40776.1| dihydrodipicolinate reductase [Pseudomonas aeruginosa 39016]
          Length = 268

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 163/267 (61%), Gaps = 4/267 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSIT-LHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+ LI+ +        L + + R  S L+G D G   G+  +G+  S +
Sbjct: 3   RIAVVGAAGRMGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L    +  D +IDF+ P++TL+++    +     +IGTTGFS  E  +++  A++ PIV 
Sbjct: 63  LGKVCEEFDVLIDFTHPSVTLKNIEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++TAA  L    + D EI+E HHR K+D+PSGTAL +GE +A    
Sbjct: 123 AANFSVGVNLCLKLLDTAARVL--GDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLQEVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALW + +  GLY M+DVLG+
Sbjct: 241 ARGAVRAALWLEGKENGLYDMQDVLGL 267


>gi|253997075|ref|YP_003049139.1| dihydrodipicolinate reductase [Methylotenera mobilis JLW8]
 gi|253983754|gb|ACT48612.1| dihydrodipicolinate reductase [Methylotenera mobilis JLW8]
          Length = 269

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 109/269 (40%), Positives = 166/269 (61%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P+++ + G  GRMG AL++ + ++  + LH  + R+ +  +G+D G   G    G++  
Sbjct: 3   NPLKVVIAGCSGRMGHALLEGVFSDVELVLHGALDRAENVHLGRDAGEQFG-RVSGVRVV 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            ++ +A++  D ++DF+ P  ++  L    ++ +  IIGTTGFSV+E +VI + A+N  I
Sbjct: 62  SDIDVALKDADVLVDFTRPEASMAYLAACQKYKVKMIIGTTGFSVEEKQVIEAAAKNIAI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+  L  LVE AA  L   + +D E++EMHHR K+D+PSGTAL LGEA A G
Sbjct: 122 VFAPNMSVGVTLLINLVEQAARVL--NEGYDIEVVEMHHRYKVDAPSGTALRLGEAAAQG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L D  V  R      R  G IG A++R G +VG+H+VV+AG GE + L+H A  R 
Sbjct: 180 LGQDLKDCAVYAREGVTGEREAGKIGFATMRGGDVVGDHTVVLAGIGERVELTHKASSRA 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G+L AA +   +  GLY MRDVLG+
Sbjct: 240 TFALGALRAAKYLAVKDSGLYDMRDVLGL 268


>gi|157376537|ref|YP_001475137.1| dihydrodipicolinate reductase [Shewanella sediminis HAW-EB3]
 gi|259586138|sp|A8FYT6|DAPB_SHESH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|157318911|gb|ABV38009.1| Dihydrodipicolinate reductase [Shewanella sediminis HAW-EB3]
          Length = 271

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 166/283 (58%), Gaps = 25/283 (8%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M   P+R+++ GG GRMG+ LI+     PSI L + I R+GS LIG D G   G+  M +
Sbjct: 1   MMSEPVRVAITGGSGRMGRTLIEAARQQPSILLGAAIERAGSTLIGVDAGELAGVGAMNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D+L   +   D +IDF+SP  ++   +  A++    +IGTTGF+  + E IS+++ +
Sbjct: 61  AITDSLDKVVDDFDILIDFTSPEASIVHTDWCARNGKAIVIGTTGFNHAQKEQISAYSES 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            PIV + NM++G+N +  L+E AA+ +    D+ D EI+E HHR K D+PSGTAL +GE 
Sbjct: 121 TPIVMAPNMAVGVNLMWKLLEVAAKVM---GDYTDIEIIEGHHRYKKDAPSGTALKMGEV 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCA----------RTEGSIGIASLRAGSIVGEHSVVIAGE 228
           IA            L R +++CA          R   +IG +++RAG +VGEH+ + A  
Sbjct: 178 IAE----------ALGRDLEKCAEYGREGITGERDRETIGFSTIRAGDLVGEHTAMFADI 227

Query: 229 GESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           GE I ++H A  R  FA G++ AA W   + PGLY M+ VLG+
Sbjct: 228 GERIEITHKASSRMTFANGAMRAASWLAEEDPGLYDMQQVLGL 270


>gi|329896046|ref|ZP_08271282.1| Dihydrodipicolinate reductase [gamma proteobacterium IMCC3088]
 gi|328922006|gb|EGG29370.1| Dihydrodipicolinate reductase [gamma proteobacterium IMCC3088]
          Length = 268

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+ V+G  GRMG+ LI+ +  +  +TL     R  S LIG D G   G+  +G+  + +
Sbjct: 3   IRVGVIGAAGRMGRTLIEALAQHEGLTLAGATERPESSLIGADAGELAGLGKLGVAIAGS 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +  +D +IDFSSP+ TL  L          +IGTTGF+V++   I++ A++ P+ K
Sbjct: 63  VQDIVADIDVLIDFSSPSATLDHLKACKSSGTAIVIGTTGFTVEQESQITAAAQHIPVCK 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SN S G+N    L++ AA  L    D D E++E HHR K+D+PSGTAL +G  +AN   
Sbjct: 123 ASNFSTGVNLCFKLLDMAARVL--GDDVDIEVIEAHHRHKVDAPSGTALSMGGVVANALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R  Q  AR   +IG A++RAG IVG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLAEVAVYGREGQTGARDRDTIGFATVRAGDIVGDHTVLFAAEGERVEITHKASSRMSF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG+L AA W  S+   LY M+DVL +
Sbjct: 241 ARGALRAAQWVVSKPASLYDMQDVLNL 267


>gi|311695970|gb|ADP98843.1| dihydrodipicolinate reductase [marine bacterium HP15]
          Length = 266

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 158/265 (59%), Gaps = 3/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++++G  GRMG+ LI+ +     + L + +V  GS LIG D G   GI   G+K + +
Sbjct: 1   MRVAIIGAAGRMGKVLIEAVDGTEGLELGAAVVEPGSSLIGADAGEMTGIGKTGVKMAGS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D ++DF+ P LTL++      +  + +IGTTG S  E + ++  A +  +V 
Sbjct: 61  LADVKDDFDVLVDFTFPDLTLENAEFCKANGKMLVIGTTGMSDAEKQQLALAAESTAVVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N +  L+ TAA  L    D+D EI+E HHR K D+PSGTAL +GE +A+   
Sbjct: 121 APNMSVGVNVVLNLLRTAAATL--GDDYDVEIIEAHHRHKKDAPSGTALRMGEVVADALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      RT   IG  ++RAG +VG+H+V+ A EGE I ++H A  R  F
Sbjct: 179 RDLKECAVYGREGFTGERTRKEIGFETIRAGDVVGDHTVLFATEGERIEVTHKASSRMTF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AALW K +  GLY M+DVL
Sbjct: 239 AKGAMRAALWLKDKPAGLYDMQDVL 263


>gi|27364029|ref|NP_759557.1| dihydrodipicolinate reductase [Vibrio vulnificus CMCP6]
 gi|34098536|sp|Q8DEM0|DAPB_VIBVU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|27360146|gb|AAO09084.1| dihydrodipicolinate reductase [Vibrio vulnificus CMCP6]
          Length = 269

 Score =  201 bits (511), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+V G  GRMG+ L+K  H+NP   + +   R  S L+G D+G   G     +   D+
Sbjct: 2   VRIAVAGAAGRMGRNLVKAAHHNPVAKVAAGSERPESSLVGVDLGELCGEGKFDVVVCDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I   D IIDF++PA TL +L +  Q+    +IGTTGF+ ++ E I   A+  P+V 
Sbjct: 62  LAKQIDQFDVIIDFTAPASTLNNLALCQQYGKSIVIGTTGFTEEQREQIDLVAQQVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLHEKPAGFYTMTDVLGL 266


>gi|312963096|ref|ZP_07777581.1| Dihydrodipicolinate reductase [Pseudomonas fluorescens WH6]
 gi|311282607|gb|EFQ61203.1| Dihydrodipicolinate reductase [Pseudomonas fluorescens WH6]
          Length = 268

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 161/265 (60%), Gaps = 4/265 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHN-NPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+ L++ +   +P+  L + IVR GS LIG D G    +  +G+  S N
Sbjct: 3   RIAVMGAAGRMGKTLVEAVQQRSPASGLTAAIVRPGSTLIGADAGELASLGRIGVSLSGN 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P + L++L    +     +IGTTG + ++ +V+    ++ P+V 
Sbjct: 63  LEQVADEFDVLIDFTLPEVMLKNLAFCRKAGKAMVIGTTGLTAEQKQVLVEAGKDIPVVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++ AA  L    + D EI+E HHR K+D+PSGTAL +GEAIA+   
Sbjct: 123 AANFSVGVNLSLKLLDMAARVL--GDEADIEIIETHHRHKIDAPSGTALRMGEAIADALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L+   V  R     AR   +IG A++R G +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLSKVAVYGREGHTGARARDTIGFATVRGGDVVGDHTVLFATEGERLEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AALW + + PGLY MRDVL
Sbjct: 241 AKGAVRAALWLEGREPGLYDMRDVL 265


>gi|238764644|ref|ZP_04625589.1| Dihydrodipicolinate reductase [Yersinia kristensenii ATCC 33638]
 gi|238697136|gb|EEP89908.1| Dihydrodipicolinate reductase [Yersinia kristensenii ATCC 33638]
          Length = 273

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 163/273 (59%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + R+GS L+G D G   G   + I
Sbjct: 1   MTDSTIRIAVVGAGGRMGRQLIQAITQTKGVVLGAAVERAGSTLVGSDAGELAGTGLLNI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L+  I + D +IDF+ P  TL+ L I   H    +IGTTGF       IS+ + +
Sbjct: 61  TVSDDLSKVIDNFDVLIDFTRPEGTLEHLAICHMHRKAMVIGTTGFDDAGKAAISAASSD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRYKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAESLGRSLKDCAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W   +  GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWVCERDNGLFDMRDVLNL 270


>gi|300112995|ref|YP_003759570.1| dihydrodipicolinate reductase [Nitrosococcus watsonii C-113]
 gi|299538932|gb|ADJ27249.1| dihydrodipicolinate reductase [Nitrosococcus watsonii C-113]
          Length = 271

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/267 (41%), Positives = 157/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G  GRMG++LI+ +     ITL +      SPLIG D G    +  + +   DN
Sbjct: 2   IRVAISGAAGRMGRSLIQAVCQYEGITLGAASECPDSPLIGSDAGEIGRVGVLQVPLVDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  + ++ D IIDF+ P +TL +L +        +IGTTGF+ ++ + I+  A   PIV 
Sbjct: 62  LDKSKEAFDLIIDFTRPEITLANLVLCRDQGKAMVIGTTGFTQEQRQKITKAAIEIPIVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+ETAA  L    + D EI+E HHR K+DSPSGTAL +GE +A    
Sbjct: 122 APNMSVGVNLCLKLLETAARVL--KDEVDIEIIEAHHRHKVDSPSGTALRMGEVVAKTLG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R   SIG +SLRAG IVGEH+V+ A EGE I +SH A  R  F
Sbjct: 180 RDLNQCAVYGRQGVSGERPRESIGFSSLRAGDIVGEHTVIFAAEGERIEISHKASSRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ A+ W   + PGLY M+DVLG+
Sbjct: 240 ALGAMRASQWVSDKPPGLYDMQDVLGL 266


>gi|254468582|ref|ZP_05081988.1| dihydrodipicolinate reductase [beta proteobacterium KB13]
 gi|207087392|gb|EDZ64675.1| dihydrodipicolinate reductase [beta proteobacterium KB13]
          Length = 267

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/272 (40%), Positives = 170/272 (62%), Gaps = 11/272 (4%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITL---HSIIVRSGSPLIGQDVGNFVGISPMGI 59
           + +++ +LG  G+MGQ LI+E   +  + L   H I   +GS  I +D G F+G     +
Sbjct: 2   NKIKVIILGASGKMGQMLIQETITDDELILVGAHDI---AGSHAIRKDAGYFIG-KETKV 57

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              DN+   +   D IIDF+ P  TL+ L  ++ +   ++IGTTGF   E ++I  ++++
Sbjct: 58  LIQDNIDHLLSECDAIIDFTRPEGTLEFLKKASDNKTSYVIGTTGFKPSELDLIQQYSQH 117

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PI  + NMS+G+N L  LVE AAE LLP  ++DFE++E HH+ K+D+PSGTAL LG+A 
Sbjct: 118 IPICMAPNMSVGVNVLISLVEKAAE-LLP--EYDFEVVEAHHKHKVDAPSGTALRLGQAA 174

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+G  ++L  + +  RH ++  R    IG +++RAG IVGEH+V+IAG GE I L+H A 
Sbjct: 175 ADGLNISLEKNAIYTRHGREEKRRNNEIGFSTIRAGDIVGEHTVLIAGNGERIELTHKAT 234

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G+L AA +  +Q P L+ M++VL +
Sbjct: 235 SRLNFASGALKAAKFVANQKPKLFDMQEVLNL 266


>gi|126175506|ref|YP_001051655.1| dihydrodipicolinate reductase [Shewanella baltica OS155]
 gi|153001911|ref|YP_001367592.1| dihydrodipicolinate reductase [Shewanella baltica OS185]
 gi|160876633|ref|YP_001555949.1| dihydrodipicolinate reductase [Shewanella baltica OS195]
 gi|217972237|ref|YP_002356988.1| dihydrodipicolinate reductase [Shewanella baltica OS223]
 gi|304410334|ref|ZP_07391953.1| dihydrodipicolinate reductase [Shewanella baltica OS183]
 gi|307301955|ref|ZP_07581713.1| dihydrodipicolinate reductase [Shewanella baltica BA175]
 gi|166224171|sp|A3D7S3|DAPB_SHEB5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166224172|sp|A6WRU0|DAPB_SHEB8 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|189082804|sp|A9L0Q8|DAPB_SHEB9 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|254767058|sp|B8E4S9|DAPB_SHEB2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|125998711|gb|ABN62786.1| dihydrodipicolinate reductase [Shewanella baltica OS155]
 gi|151366529|gb|ABS09529.1| Dihydrodipicolinate reductase [Shewanella baltica OS185]
 gi|160862155|gb|ABX50689.1| Dihydrodipicolinate reductase [Shewanella baltica OS195]
 gi|217497372|gb|ACK45565.1| Dihydrodipicolinate reductase [Shewanella baltica OS223]
 gi|304351743|gb|EFM16142.1| dihydrodipicolinate reductase [Shewanella baltica OS183]
 gi|306913993|gb|EFN44414.1| dihydrodipicolinate reductase [Shewanella baltica BA175]
 gi|315268831|gb|ADT95684.1| dihydrodipicolinate reductase [Shewanella baltica OS678]
          Length = 270

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 161/268 (60%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G GGRMG+ LI+  +N+  I L + I R+GS L+G D G   G+  + +   D+
Sbjct: 5   VRVAIVGAGGRMGRTLIEAAYNHDHILLGAAIERAGSSLVGVDAGELAGVGKLKVMIMDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A    D +IDF++P  ++  L+   +H    +IGTTGF+  + E I++FA   P+V 
Sbjct: 65  LDYATDDFDVLIDFTAPDASIVHLDWCVRHKKAMVIGTTGFNHAQKEQINAFAEQTPVVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWKLLELAAEVM---GDYTDIEIIEGHHRHKKDAPSGTALKMGEVIAKTL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLEKCAVYGREGITGERDRETIGFATIRAGDLVGEHTAMFADIGERLEITHKASSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 242 FANGAMRAAHWLVEQKPGLYDMQQVLGL 269


>gi|323497904|ref|ZP_08102913.1| dihydrodipicolinate reductase [Vibrio sinaloensis DSM 21326]
 gi|323316949|gb|EGA69951.1| dihydrodipicolinate reductase [Vibrio sinaloensis DSM 21326]
          Length = 269

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+V G  GRMG+ L+K  + N    + +   R  S LIG DVG   G     +  +D+
Sbjct: 2   VRIAVAGAAGRMGRNLVKASYLNQQAQVGAGSERPESSLIGVDVGELCGEGKFDVVLTDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   I + D IIDF++PA TL +L +   H    +IGTTGF+ +E E+I + A+  P+V 
Sbjct: 62  LTKEINNFDVIIDFTAPASTLANLELCRHHGKSIVIGTTGFTDQERELIDTVAKEVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLNDVAVYAREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEVTHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W K +  G Y+M DVLG+
Sbjct: 240 ANGAVKAAVWLKEKPAGFYTMTDVLGL 266


>gi|227358196|ref|ZP_03842537.1| dihydrodipicolinate reductase [Proteus mirabilis ATCC 29906]
 gi|227161532|gb|EEI46569.1| dihydrodipicolinate reductase [Proteus mirabilis ATCC 29906]
          Length = 273

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/272 (40%), Positives = 161/272 (59%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R++V+G GGRMG+ LI+ I+    + L +   R+ S LIG D G   GI  +GI
Sbjct: 1   MSATELRLAVVGAGGRMGRQLIQAINQQQGVVLGAAFERTNSSLIGADAGELAGIGHIGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +DNL   +   D +IDF+ P  TL  L    +H+   IIGTTGF  +  + I+  A+ 
Sbjct: 61  TVTDNLLAQVGQFDILIDFTRPEGTLSHLAFCVEHHKGMIIGTTGFDEEGKKAINCAAQT 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE+I
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM--GSYSDIEIVEAHHRHKVDAPSGTALAMGESI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L D  V  R      R   SIG A++RAG IVGEH+ + A  GE + +SH A 
Sbjct: 179 AETLGRDLKDCAVYQRVGHTGERDPSSIGFATIRAGDIVGEHTAIFADIGERVEISHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G++ +A+W   +  GLY+M+DVL +
Sbjct: 239 SRMTFANGAVKSAIWLSERKSGLYNMKDVLSL 270


>gi|53803857|ref|YP_114291.1| dihydrodipicolinate reductase [Methylococcus capsulatus str. Bath]
 gi|81681777|sp|Q607A7|DAPB_METCA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|53757618|gb|AAU91909.1| dihydrodipicolinate reductase [Methylococcus capsulatus str. Bath]
          Length = 269

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 157/258 (60%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG  L++    +P++ L + I R GSP++G+D G   G+S +G+    NL+     VD
Sbjct: 12  GRMGGNLVRACLADPAVELTAAIARPGSPVVGRDAGELAGLSAIGLPVVGNLSEVSDKVD 71

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+ P +TL  L       I  +IGTTGFS ++ ++I++ A    IV + NMS+G+N
Sbjct: 72  VLIDFTLPEVTLAHLESCRSAGIRLVIGTTGFSAEQRQLIAAAAEGMGIVFAPNMSVGVN 131

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
               L++ AA  +   +  D EI+E HHR K+D+PSGTAL +GE +A     NL D  + 
Sbjct: 132 LALKLLDIAARVV--GEHADIEIVEAHHRHKIDAPSGTALRMGEVVAKALGRNLQDCAIY 189

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R   +IG +++RAG IVGEH+V+ A EGE I ++H A  R  FA+G++ AA+
Sbjct: 190 GREGITGIRDAKTIGFSTIRAGDIVGEHTVMFADEGERIEITHKASSRMTFAKGAVRAAV 249

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W  SQ  GL+ M+DVLG+
Sbjct: 250 WLMSQGEGLFDMQDVLGL 267


>gi|168234809|ref|ZP_02659867.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194735525|ref|YP_002113077.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|238693711|sp|B4TWQ6|DAPB_SALSV RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|194711027|gb|ACF90248.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197291667|gb|EDY31017.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|322615886|gb|EFY12803.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620671|gb|EFY17531.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623978|gb|EFY20815.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627426|gb|EFY24217.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322630733|gb|EFY27497.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638047|gb|EFY34748.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640531|gb|EFY37182.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647671|gb|EFY44156.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648378|gb|EFY44833.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656945|gb|EFY53231.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657344|gb|EFY53616.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663664|gb|EFY59864.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666497|gb|EFY62675.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672344|gb|EFY68456.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676344|gb|EFY72415.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679563|gb|EFY75608.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686108|gb|EFY82092.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323194952|gb|EFZ80138.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200139|gb|EFZ85226.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201040|gb|EFZ86109.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209437|gb|EFZ94370.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212311|gb|EFZ97135.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216616|gb|EGA01342.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219340|gb|EGA03826.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225756|gb|EGA09976.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323228703|gb|EGA12832.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236683|gb|EGA20759.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239816|gb|EGA23863.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242136|gb|EGA26165.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249439|gb|EGA33355.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252226|gb|EGA36077.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256683|gb|EGA40413.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323265537|gb|EGA49033.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323271675|gb|EGA55093.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 273

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 108/273 (39%), Positives = 161/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R++++G GGRMG+ LI+       + L + + R GS L+G D G   G+   G+
Sbjct: 1   MHEAQIRVAIVGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGVGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +LA      D ++DF+ P  TL  L    +H    +IGTTGF     + I   ++ 
Sbjct: 61  IIQSDLASVKDDFDVLVDFTRPEGTLAHLAFCRKHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|219872276|ref|YP_002476651.1| dihydrodipicolinate reductase [Haemophilus parasuis SH0165]
 gi|254767050|sp|B8F8Q1|DAPB_HAEPS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|219692480|gb|ACL33703.1| dihydrodipicolinate reductase [Haemophilus parasuis SH0165]
          Length = 270

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 155/266 (58%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I V+G GGRMG+ LI+ ++N   + L S   R GS L+G D G   GI  +G+  +D
Sbjct: 2   TLKIGVVGAGGRMGRQLIQAVNNTEGVELGSAFERKGSSLVGADAGELAGIGHLGVTVTD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +LA  +   D +IDF+ P  TL+ +     HN   +IGTTGF     + I S +    IV
Sbjct: 62  DLASQLNHFDLLIDFTRPEGTLEHIAFCVAHNKKMVIGTTGFDDAGKQAIKSASEEISIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +     +D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYYDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE I ++H A  R  
Sbjct: 180 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERIEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W +++  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLQTKQNGLFDMTDVL 265


>gi|322834467|ref|YP_004214494.1| dihydrodipicolinate reductase [Rahnella sp. Y9602]
 gi|321169668|gb|ADW75367.1| dihydrodipicolinate reductase [Rahnella sp. Y9602]
          Length = 273

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 158/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R++V+G GGRMG+ LI+ I +   + L + + R+GS L+G D G   G+   GI
Sbjct: 1   MSNADIRMAVVGAGGRMGRQLIQAISDAEGVVLGAALERTGSSLVGTDAGELAGVGTAGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K  DNL       D +IDF+ P  TL  L    +H+   IIGTTGF       I   +  
Sbjct: 61  KVHDNLDAVKNDFDILIDFTRPEGTLAHLEFCQKHHKGMIIGTTGFDDAGKAAIKQASEV 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            P+V ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IPVVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIVEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADALGRDLKDCAVYAREGHTGERDPKSIGFATIRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ A  W  S   GLY MRDVLG+
Sbjct: 238 SSRMTFANGAVRAGKWLFSHKSGLYDMRDVLGL 270


>gi|119478521|ref|ZP_01618483.1| dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2143]
 gi|119448502|gb|EAW29750.1| dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2143]
          Length = 272

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 161/268 (60%), Gaps = 3/268 (1%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I+V G  GRMG+ LI+ I+ +P   L + I  S SP +G D G   G+   GI    
Sbjct: 6   AVKIAVTGAAGRMGKTLIEAINLHPDAELTAAIEWSESPAVGVDSGELAGLGKNGISIVA 65

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           N+   I   D +IDF++PA T+ +  + + +    IIGTTG S  +   I+S A  + I 
Sbjct: 66  NINDVIDHFDVLIDFTAPAATVANSKVCSVNGKKMIIGTTGCSEDDKASIASAANQSAIC 125

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            ++N S G+N    L+  AA+ L    D+D EI+E HHR K+D+PSGTAL +GEA+A+G 
Sbjct: 126 MATNFSTGVNVCFKLLNDAAKIL--GDDYDVEIVEAHHRHKVDAPSGTALSMGEAVADGL 183

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
           + NL D  V  R  Q  ARTE  IG A++R G +VG+H+V+   +GE + +SH A  R  
Sbjct: 184 QRNLKDVAVYGREGQVGARTEKEIGFATVRGGDVVGDHTVMFLADGERVEISHKASSRMS 243

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           F RG++ AA+W  +Q  GL+ M+DVLG+
Sbjct: 244 FGRGAVRAAVWIAAQDKGLFDMQDVLGL 271


>gi|319784374|ref|YP_004143850.1| dihydrodipicolinate reductase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170262|gb|ADV13800.1| dihydrodipicolinate reductase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 259

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 162/274 (59%), Gaps = 19/274 (6%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M Q P+RI++ G  GRMG+ +   +  +P + L +   R G+      VG+       G+
Sbjct: 1   MPQPPIRIAIAGALGRMGRQMTDAVRVDPRLALAARFHRPGA------VGD-------GL 47

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQ-SLNISAQHNIVHIIGTTGFSVKENEVISSFAR 118
              +    A+ + D +IDF++PA +   +   +A+     +IG+TGF   E   I+  A+
Sbjct: 48  VSREE---ALATADVVIDFTTPAASADLARFCAARGGPALVIGSTGFDATEFADIAEAAK 104

Query: 119 NAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEA 178
              IV+S + SLG+N L  LVE AA  L P +DWD E+ E HHR K+D+PSGTAL+LG+A
Sbjct: 105 TIAIVRSGSFSLGLNMLVGLVEQAATALDP-EDWDAEVFEAHHRHKIDAPSGTALMLGQA 163

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           +A GRKV L       R     AR  G IG A LR GSI+GEHSV    EGE +TLSH+A
Sbjct: 164 VAGGRKVELDAVARPVRDGAIGARPPGEIGFAVLRGGSIIGEHSVSFCAEGELVTLSHAA 223

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
            DR +FARG++ AALW + + PG Y MRDVLG G
Sbjct: 224 GDRVMFARGAIAAALWLEGRPPGEYDMRDVLGFG 257


>gi|161504819|ref|YP_001571931.1| dihydrodipicolinate reductase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189082802|sp|A9MR41|DAPB_SALAR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|160866166|gb|ABX22789.1| hypothetical protein SARI_02943 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 273

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 162/273 (59%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R++++G GGRMG+ LI+   +   I   + + R GS L+G D G   G+  MG+
Sbjct: 1   MHEAQIRVAIVGAGGRMGRQLIQAALHMEGIQPGAALEREGSSLLGSDAGELAGVGKMGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +LA+     D ++DF+ P  TL  L    +H    +IGTTGF     + I   A+ 
Sbjct: 61  IVQSDLALVKDDFDVLVDFTRPEGTLAHLAFCRKHGKSMVIGTTGFDEAGKQAIRDAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E  A+ +    D+ D EI+E HHR K+D+PSGTAL +GE 
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKTAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGET 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG I+GEH+ + A  GE + ++H A
Sbjct: 178 IAHALNKDLQDCAVYSREGHTGERVPGTIGFATVRAGDIIGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|88801012|ref|ZP_01116562.1| dihydrodipicolinate reductase [Reinekea sp. MED297]
 gi|88776279|gb|EAR07504.1| dihydrodipicolinate reductase [Reinekea sp. MED297]
          Length = 268

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 159/266 (59%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I V G  GRMG+ALI+ +     + L   +VR  S  IG D G  +G   + +  +D +
Sbjct: 3   KIVVTGADGRMGRALIEAVCATDGVVLSGAVVRDDSGFIGIDAGELIGRPKLDVIVTDEV 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
              +     +IDF++P  TL  L+++ +     +IGTTGFS ++ E + S+    P+V +
Sbjct: 63  RQVMNPEVTLIDFTAPEATLNHLSVAKELGGRLVIGTTGFSDEQLETLRSYQNEVPMVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            N S+G+N    L+  AA+ +   +  D E++E HHR K+D+PSGTAL++GEA+A    V
Sbjct: 123 GNYSVGVNLTLQLLRQAAKII--GESSDIEVIEAHHRHKVDAPSGTALMMGEAVAEAMDV 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           NL D  V +R     AR  GSIG +++R G IVGEH+V+ A EGE + +SH A  R+ FA
Sbjct: 181 NLKDVGVFSREGITGAREPGSIGFSTIRGGDIVGEHTVMFASEGERVEISHKASSRQTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG++ AA W  SQ  GLYSM DVLG 
Sbjct: 241 RGAVRAARWLLSQPKGLYSMEDVLGF 266


>gi|205351407|ref|YP_002225208.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|226696361|sp|B5RG99|DAPB_SALG2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|205271188|emb|CAR35975.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326626427|gb|EGE32770.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 273

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 158/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G+   G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGVGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     NL D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|197283934|ref|YP_002149806.1| dihydrodipicolinate reductase [Proteus mirabilis HI4320]
 gi|238690108|sp|B4F2T9|DAPB_PROMH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|194681421|emb|CAR40259.1| dihydrodipicolinate reductase [Proteus mirabilis HI4320]
          Length = 273

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/272 (40%), Positives = 161/272 (59%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R++V+G GGRMG+ LI+ I+    + L +   R+ S LIG D G   GI  +GI
Sbjct: 1   MSATELRLAVVGAGGRMGRQLIQAINQQQGVVLGAAFERTNSSLIGADAGELAGIGHIGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +DNL   +   D +IDF+ P  TL  L    +H+   IIGTTGF  +  + I+  A+ 
Sbjct: 61  TVTDNLLAQVGQFDILIDFTRPEGTLSHLAFCVEHHKGMIIGTTGFDEEGKKAINCAAQT 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE+I
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM--GSYSDIEIVEAHHRHKVDAPSGTALAMGESI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L D  V  R      R   SIG A++RAG IVGEH+ + A  GE + +SH A 
Sbjct: 179 AETLGRDLKDCAVYQRVGHTGERDPRSIGFATIRAGDIVGEHTAIFADIGERVEISHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G++ +A+W   +  GLY+M+DVL +
Sbjct: 239 SRMTFANGAVKSAIWLSEKKSGLYNMKDVLSL 270


>gi|156306282|ref|XP_001617576.1| hypothetical protein NEMVEDRAFT_v1g225968 [Nematostella vectensis]
 gi|156194643|gb|EDO25476.1| predicted protein [Nematostella vectensis]
          Length = 275

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 158/272 (58%), Gaps = 3/272 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + +++ ++G GGRMGQAL+  + +     L     R GSP IG  + + +      +  S
Sbjct: 6   TEIKVGIVGCGGRMGQALVGAVLDQEKTVLSGGTERHGSPYIGNIIRHPLTGVETSLAIS 65

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+        D +IDF+ P  T+     +A++N VHI GTTG + ++ + +   A++ P+
Sbjct: 66  DDAEKLFMVSDVVIDFTCPTATVLHAVYAAKYNTVHIAGTTGMTAEDEKALQEAAKSVPV 125

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V +SN SLG+N L +L + AA+ L   +D+D EILEMHHR K+D+PSGTAL LG   A G
Sbjct: 126 VYASNFSLGVNLLFYLTQKAAQML--DEDFDIEILEMHHRHKVDAPSGTALSLGLQAAKG 183

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V+L       R      R  G IG A LR G++ GEH+V      E + L+H A DR 
Sbjct: 184 RGVDLNKVSDKARDGITGERKRGDIGFAVLRGGNVAGEHTVSFNANDERVELTHKAGDRA 243

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIGLD 274
           IFARG++ AALWA  + PGL+ M DVLG+  D
Sbjct: 244 IFARGAVKAALWAVGKKPGLFDMFDVLGLPKD 275


>gi|62178628|ref|YP_215045.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224581903|ref|YP_002635700.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|75484914|sp|Q57TJ7|DAPB_SALCH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|254767057|sp|C0Q4K5|DAPB_SALPC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|62126261|gb|AAX63964.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224466430|gb|ACN44260.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322713079|gb|EFZ04650.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 273

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 158/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G+   G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGVGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  TVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKDLKDCAVYSREGYTGERVAGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|167550761|ref|ZP_02344518.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205324337|gb|EDZ12176.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 273

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 111/273 (40%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     NL D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L AALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRAALWLKTKKNGLFDMRDVLGL 270


>gi|268592109|ref|ZP_06126330.1| dihydrodipicolinate reductase [Providencia rettgeri DSM 1131]
 gi|291312505|gb|EFE52958.1| dihydrodipicolinate reductase [Providencia rettgeri DSM 1131]
          Length = 273

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 159/272 (58%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +R++++G GGRMG+ LI+       I L + I R GS LIG D G   GI  +GI
Sbjct: 1   MANSMVRVAIVGAGGRMGRQLIQAAQQQDGIQLGAAIEREGSSLIGTDAGELAGIGKLGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+L   +   D +IDF+ P  TL  L     +    +IGTTGF  +  + I+  A++
Sbjct: 61  AIVDSLNQVVNDFDVVIDFTRPEGTLHYLAFCKANQKAMVIGTTGFDEQGKQAIAEAAKS 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE+I
Sbjct: 121 IPIVFAANFSVGVNVVLKLLEKAAKVM--GNYTDIEIVEAHHRHKVDAPSGTALAMGESI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L +  V  R      R  G+IG A++RAG IVGEH+ + A  GE + +SH A 
Sbjct: 179 ASALGKDLKECAVYTREGYTGEREPGTIGFATIRAGDIVGEHTAMFADIGERVEISHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G++ A+ W  ++  GLY M+DVL +
Sbjct: 239 SRMTFANGAIKASGWVCAKNNGLYDMKDVLNL 270


>gi|146278957|ref|YP_001169116.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides ATCC 17025]
 gi|166224165|sp|A4WWP7|DAPB_RHOS5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|145557198|gb|ABP71811.1| dihydrodipicolinate reductase [Rhodobacter sphaeroides ATCC 17025]
          Length = 269

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 154/258 (59%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L++ +  +    L   + R GS  +G+D G  +G + +G+  +D+   A     
Sbjct: 14  GRMGQMLMRTVLASDKARLVGAVERPGSEWVGRDAGAAMGGAAIGVTVTDDPLEAFAQAQ 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+SP  T++   ++AQ   VH+IGTTG      E +   A +A IV++ NMSLG+N
Sbjct: 74  AVIDFTSPEATVRFAELAAQARAVHVIGTTGLDPAHLEKLEWAAHHAVIVRAGNMSLGVN 133

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L +  AE L    DWD E++E HHR K+D+PSGTAL+LGEA A GR  +L    V 
Sbjct: 134 LLTRLTQKVAEAL--DADWDIEVVEAHHRMKVDAPSGTALMLGEAAARGRGTDLDRARVS 191

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  GSIG +++R G IVGEH V+ A  GE I L H A DR IFARG+L AAL
Sbjct: 192 GRDGITGPRAPGSIGFSAIRGGDIVGEHDVIFAAAGERIVLRHVATDRAIFARGALRAAL 251

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y M DVLG+
Sbjct: 252 WGQDKRPGQYDMIDVLGL 269


>gi|90580539|ref|ZP_01236344.1| dihydrodipicolinate reductase [Vibrio angustum S14]
 gi|90438197|gb|EAS63383.1| dihydrodipicolinate reductase [Photobacterium angustum S14]
          Length = 269

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 156/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L++    +    L     R+GS L+G D G   G     +   D+
Sbjct: 2   VRIAIAGAAGRMGRQLLRATQLSEKAELGVATERAGSTLVGADAGELAGTGIANVIIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF++P  TL ++    QHN   +IGTTGF+ +E E+I   AR+  IV 
Sbjct: 62  LNKALDDFDVLIDFTAPVATLANIEFCQQHNKKIVIGTTGFTEQERELIDLAARDISIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   + PG Y+M DVLG+
Sbjct: 240 ANGAVRAAVWLNDKSPGFYTMEDVLGL 266


>gi|212709133|ref|ZP_03317261.1| hypothetical protein PROVALCAL_00166 [Providencia alcalifaciens DSM
           30120]
 gi|212688045|gb|EEB47573.1| hypothetical protein PROVALCAL_00166 [Providencia alcalifaciens DSM
           30120]
          Length = 273

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 161/271 (59%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +R++++G GGRMG+ LI+       I L + I R GS LIG D G   GI  +G+
Sbjct: 1   MADSTVRVAIVGAGGRMGRQLIQAAQEQDGIQLGAAIEREGSSLIGIDAGELAGIGQIGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K   +L   +   D +IDF+ P  TLQ L     H    +IGTTGF  +    I+  +++
Sbjct: 61  KVVGHLDSVVNDFDVLIDFTRPEGTLQYLAFCQSHQKGMVIGTTGFDEQGKLAIAEASKS 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            PIV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE+
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGES 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L +  V  R      R  G+IG A++RAG IVGEH+ + A  GE + +SH A
Sbjct: 178 IADALGKDLKECAVYAREGYTGEREPGTIGFATVRAGDIVGEHTAMFADIGERVEISHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA+G++ A+ W   +  GLY+M+DVL
Sbjct: 238 SSRMTFAKGAIRASSWVNGKKDGLYNMKDVL 268


>gi|332288779|ref|YP_004419631.1| dihydrodipicolinate reductase [Gallibacterium anatis UMN179]
 gi|330431675|gb|AEC16734.1| dihydrodipicolinate reductase [Gallibacterium anatis UMN179]
          Length = 270

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 151/266 (56%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            +RI+V+G GGRMG+ LI+ I     + L +   R GS L+G D G   GI   GI  SD
Sbjct: 2   SLRIAVVGAGGRMGRQLIQAISKADGVQLTAAFEREGSSLVGSDAGELAGIGHNGIAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           NLA    + D +IDF+ P  TL  L     +N   +IGTTGF  +  + I   A    IV
Sbjct: 62  NLAQQADNFDLLIDFTRPEGTLVHLAFCNANNKKMVIGTTGFDEQGKQAIKQAAEKIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKAM 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             NL DH V  R      R +  IG A++RAG +VGEH+V  A EGE + ++H A  R  
Sbjct: 180 GKNLKDHAVYAREGITGERKQDQIGFATIRAGDVVGEHTVWFADEGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  +   GL+ M DVL
Sbjct: 240 FANGAVRAAKWLANHDKGLFDMTDVL 265


>gi|322421970|ref|YP_004201193.1| dihydrodipicolinate reductase [Geobacter sp. M18]
 gi|320128357|gb|ADW15917.1| dihydrodipicolinate reductase [Geobacter sp. M18]
          Length = 267

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 165/271 (60%), Gaps = 11/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMG  +I  I  +  + L   + R G P++GQD G   G+  +GI  SD+
Sbjct: 2   VKIAVCGAAGRMGGRIIAAIRESEGVELSGALERPGHPMVGQDAGYNAGLGAIGIAISDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +Q  D +IDF++P ++L++L + A      +IG+TGF+ +E  + +  AR  P++ 
Sbjct: 62  LNAVVQGCDVLIDFTAPKVSLKNLEVCALFKKSIVIGSTGFTPEERALAAELAREIPVII 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    ++   A+ L   +D+D EI+E HHR K DSPSGTA+ +GE +AN  G
Sbjct: 122 APNMSVGVNVCFKVLADVAKIL--GEDFDVEIVEAHHRLKKDSPSGTAVRMGEVVANALG 179

Query: 183 RKVNLTDHMVLNRHIQQ-CA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT   IG+ ++R G IVGEH+V   G GE I L+H A+ 
Sbjct: 180 RDYN----KVANYHREGICGERTHDEIGMQTVRGGDIVGEHTVYFIGMGERIELTHRAHT 235

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RGS+ AA W  +  PG++ M+DVLG+
Sbjct: 236 RDMFSRGSVRAAKWVVTAKPGVWDMQDVLGL 266


>gi|37196768|dbj|BAC92755.1| dihydrodipicolinate reductase [Methylophilus methylotrophus]
          Length = 268

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 156/258 (60%), Gaps = 3/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG AL+  + ++  + LH+ + R+ S +IG+D G   G    G+K + ++  A+   D
Sbjct: 11  GRMGHALLDGVFSDNGLQLHAALDRAESAMIGRDAGEQFG-KVSGVKITADIHAALVGAD 69

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            ++DF+ P  ++Q L    Q N+  +IGTTGFS  E   I + ++N  IV + NMS+G+ 
Sbjct: 70  VLVDFTRPEASMQYLQACQQANVKLVIGTTGFSEAEKASIEAASKNIGIVFAPNMSVGVT 129

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LVE AA  L   + +D E++EMHHR K+D+PSGTAL LGEA A G    L D  V 
Sbjct: 130 LLINLVEQAARVL--NEGYDIEVVEMHHRHKVDAPSGTALRLGEAAAKGIDKALKDCAVY 187

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  G+IG A+LR G +VG+H+VV+AG GE + L+H A  R  FA+G+L AA 
Sbjct: 188 AREGVTGEREAGTIGFATLRGGDVVGDHTVVLAGVGERVELTHKASSRATFAQGALRAAK 247

Query: 254 WAKSQIPGLYSMRDVLGI 271
           +   +  GL+ MRDVLG 
Sbjct: 248 FLADKPKGLFDMRDVLGF 265


>gi|157368957|ref|YP_001476946.1| dihydrodipicolinate reductase [Serratia proteamaculans 568]
 gi|167012023|sp|A8G9M8|DAPB_SERP5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|157320721|gb|ABV39818.1| Dihydrodipicolinate reductase [Serratia proteamaculans 568]
          Length = 273

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 111/273 (40%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V G GGRMG+ LI+ +   P + L + I R GS LIG D G   G+  +G+
Sbjct: 1   MTDSLIRIAVAGSGGRMGRQLIQAVQQAPGVVLGAAISRPGSSLIGTDAGELAGVGALGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L   +   D +IDF+ P  TL  L    +H    +IGTTGF     + I +  + 
Sbjct: 61  TVSDSLEKVVDDFDILIDFTRPESTLAYLAFCVEHKKAMVIGTTGFDDAGKDAIRAAGQQ 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNLVLKLLEKAAQVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L +  V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALGRDLKECAVYAREGYTGERDPKSIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA W  +   GL+ MRDVL +
Sbjct: 238 SSRMTFASGAVRAASWLHNHDKGLFDMRDVLNL 270


>gi|149926216|ref|ZP_01914478.1| putative dihydrodipicolinate reductase [Limnobacter sp. MED105]
 gi|149825034|gb|EDM84246.1| putative dihydrodipicolinate reductase [Limnobacter sp. MED105]
          Length = 272

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 166/268 (61%), Gaps = 4/268 (1%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P++I++ G  GRMG+ LI+ I N+P   L     ++ SP IG+D G+F+GIS  G+  +D
Sbjct: 4   PLQIAIAGASGRMGKTLIEAILNHPDCELAGAFDQADSPSIGRDAGDFMGISS-GVLVTD 62

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           N   A+ + D +IDF+ P  TL  L +  +H +  +IGTTGF  K+ E +   A    +V
Sbjct: 63  NTDAALSNADVLIDFTRPEGTLHHLALCEKHGVKAVIGTTGFEPKQLEALKKAAEKVAMV 122

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            S NM++G+N    L+E AA+ L  ++ +D E++E HH +K+D+PSGTAL +GE IA G 
Sbjct: 123 WSPNMAVGVNATFKLLEVAAKIL--SQGYDIEVIEAHHSKKVDAPSGTALRMGEVIAKGL 180

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
            V+L +  V  R      R  G+IG +++R G IVG+H+V+ AG GE I ++H +  R  
Sbjct: 181 GVDLQEVGVFAREGITGERKAGTIGFSTIRGGDIVGDHTVLFAGIGERIEITHKSSSRMT 240

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +A+GS+ AA +      GL+ M+DVLG+
Sbjct: 241 YAQGSIRAAQFLIGHEKGLFDMQDVLGL 268


>gi|300715266|ref|YP_003740069.1| dihydrodipicolinate reductase [Erwinia billingiae Eb661]
 gi|299061102|emb|CAX58209.1| Dihydrodipicolinate reductase [Erwinia billingiae Eb661]
          Length = 273

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 106/273 (38%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M+ + +R++++G  GRMG+ LI+       + L + +VR GS L+G D G   G    G+
Sbjct: 1   MNNAQIRLAIVGAAGRMGRQLIQAAQEADGVCLGAALVREGSSLVGVDAGELAGTGTTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           + SDNL   +   D +IDF+ P  TL  L+   QH    +IGTTG        I   +  
Sbjct: 61  RISDNLDAVVNDFDVLIDFTRPEGTLAYLDFCRQHQKAMVIGTTGLDDSAKAAIKQASHE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNLVLKLLEKAAKVM---GDYADIEIVEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L +H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADAMDWDLNEHAVYAREGHTGERKAQTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA+G++ AA W  ++  GLY MR VL +
Sbjct: 238 SSRMTFAKGAVRAADWLSTRKAGLYDMRSVLNL 270


>gi|229592650|ref|YP_002874769.1| dihydrodipicolinate reductase [Pseudomonas fluorescens SBW25]
 gi|251757256|sp|Q84CP9|DAPB_PSEFS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|229364516|emb|CAY52371.1| dihydrodipicolinate reductase [Pseudomonas fluorescens SBW25]
          Length = 268

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 162/265 (61%), Gaps = 4/265 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHN-NPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+ L++ +   +P+  L + IVR GS LIG D G    +  +G+  S N
Sbjct: 3   RIAVMGAAGRMGKTLVEAVQQRSPASGLTAAIVRPGSTLIGADAGELASLGRIGVSLSGN 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P + L++L    +     +IGTTG ++++ ++++   ++ PIV 
Sbjct: 63  LEQVADEFDVLIDFTLPDVMLKNLAFCRKAGKAMVIGTTGLTLEQKQLLAEAGKDIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++ AA  L    + D EI+E HHR K+D+PSGTAL +GEAIA+   
Sbjct: 123 AANFSVGVNLSLKLLDLAARVL--GDEADIEIIETHHRHKIDAPSGTALRMGEAIADALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L+   V  R     AR   +IG A++R G +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLSKVAVYGREGHTGARARDTIGFATVRGGDVVGDHTVLFASEGERLEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AALW + +  GLY MRDVL
Sbjct: 241 AKGAVRAALWLEGRAAGLYDMRDVL 265


>gi|329296594|ref|ZP_08253930.1| dihydrodipicolinate reductase [Plautia stali symbiont]
          Length = 271

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 155/272 (56%), Gaps = 5/272 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +RI+++G  GRMG+ LI+       + L + + RSGS L+G D G   GI   G++ +
Sbjct: 2   SEIRIAIVGAPGRMGRNLIQSAQQAEGVVLGAALARSGSSLLGADAGELAGIGKTGVRVT 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+L   +   D +IDF+ P  TL  L    QH    +IGTTGF       I   A    I
Sbjct: 62  DDLLQVVNDFDVLIDFTRPEGTLAYLAFCRQHQKAMVIGTTGFDEAGKAAIREAAEEIGI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           V ++N S+G+N +  L++ AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEAIA+
Sbjct: 122 VFAANFSVGVNLVLNLLQQAAKVM---GDYADIEIVEAHHRHKVDAPSGTALAMGEAIAD 178

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
                L +H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A  R
Sbjct: 179 AMHWKLDEHAVYARESHTGERKAQTIGFATVRAGDIVGEHTAMFADIGERVEITHKASSR 238

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGIGL 273
             FA G++ AA W K +  GLY MR VL + +
Sbjct: 239 MTFANGAVKAAAWLKDKKSGLYDMRKVLDLSM 270


>gi|117919415|ref|YP_868607.1| dihydrodipicolinate reductase [Shewanella sp. ANA-3]
 gi|166224175|sp|A0KTT2|DAPB_SHESA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|117611747|gb|ABK47201.1| dihydrodipicolinate reductase [Shewanella sp. ANA-3]
          Length = 270

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 160/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G GGRMG+ LI+  ++   I L + I R GS L+G D G  VG+  + +   D+
Sbjct: 5   VRVAIVGAGGRMGRTLIESAYHQEHIRLGAAIERPGSSLVGVDAGELVGVGKLNVIIMDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A    D +IDF++P  ++  L+   +H    +IGTTGF+  + E I++FA   P+V 
Sbjct: 65  LDYATDDFDVLIDFTAPEASIVHLDWCVRHKKAMVIGTTGFNHAQKEQINAFAEQTPVVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWKLLELAAEVM---GDYTDIEIIEGHHRYKKDAPSGTALKMGEVIAKTL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLEKCAVYGREGITGERDRETIGFATVRAGDLVGEHTAMFADIGERLEITHKASSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 242 FANGAMRAAHWLVEQKPGLYDMQQVLGL 269


>gi|149186370|ref|ZP_01864683.1| Dihydrodipicolinate reductase [Erythrobacter sp. SD-21]
 gi|148829959|gb|EDL48397.1| Dihydrodipicolinate reductase [Erythrobacter sp. SD-21]
          Length = 242

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 155/265 (58%), Gaps = 27/265 (10%)

Query: 8   ISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLA 66
           I V+G  G MG+AL + I  +     H     +G    G DVG    +S           
Sbjct: 4   IGVIGSKGAMGEALRRVIEASG----HDC---AGGADKGDDVGELAKVS----------- 45

Query: 67  MAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSS 126
                 D ++DFS+PA    +L+ + +  +  +IGTTG     +E+I + AR   ++++ 
Sbjct: 46  ------DALVDFSAPAALQANLDAAVRAGVPIVIGTTGLDSNHHEMIETAAREIAVLQTG 99

Query: 127 NMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVN 186
           N SLG+  L  LV  AA  L   +DWD EI+EMHHRRK+D+PSGTALLLGEA A  RKV+
Sbjct: 100 NTSLGVTLLAHLVREAAARL--DEDWDIEIVEMHHRRKVDAPSGTALLLGEAAAKARKVS 157

Query: 187 LTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFAR 246
           L D     R  Q   RT G+IG A+LR GS+ G+HSV+ AGE E ITLSHSA +R IFAR
Sbjct: 158 LDDVSESGRDGQTGPRTSGAIGFAALRGGSVAGDHSVIFAGEEERITLSHSAENRTIFAR 217

Query: 247 GSLTAALWAKSQIPGLYSMRDVLGI 271
           G++ AA W +   PG YSM +VLGI
Sbjct: 218 GAIRAAEWLREAEPGRYSMEEVLGI 242


>gi|170025799|ref|YP_001722304.1| dihydrodipicolinate reductase [Yersinia pseudotuberculosis YPIII]
 gi|238688445|sp|B1JKZ4|DAPB_YERPY RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|169752333|gb|ACA69851.1| Dihydrodipicolinate reductase [Yersinia pseudotuberculosis YPIII]
          Length = 273

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 161/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+++G GGRMG+ LI+ +     + L + I R GS L+G D G   G+  + +
Sbjct: 1   MTDSTIRIAIVGAGGRMGRQLIQAVTQMEGVVLGAAIERKGSTLVGSDAGELAGVGLLNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+L+    + D +IDF+ P  TL+ L I  QH    +IGTTGF       IS  A +
Sbjct: 61  IVGDDLSQLTDNFDVLIDFTRPEGTLEHLAICRQHRKAMVIGTTGFDEAGKAAISEAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADAMGRSLKDCAVYSREGYTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W      GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWLGKHDNGLFDMRDVLNL 270


>gi|312173566|emb|CBX81820.1| Dihydrodipicolinate reductase [Erwinia amylovora ATCC BAA-2158]
          Length = 273

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 156/272 (57%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +RI+++G  GRMG+ LI+         L + +VRSGS L+G D G   G   +GI
Sbjct: 1   MSNAEIRIAIVGAAGRMGRQLIQATEQAEGARLGAALVRSGSSLVGSDAGELAGCGALGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +DNL       D +IDF+ P  TL  L    QH    +IGTTGF       I + A+ 
Sbjct: 61  TITDNLEAVANDFDVLIDFTRPQATLHYLAFCRQHQKTMVIGTTGFDDAGKAAIEAAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  LVE AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNLVLKLVEKAAKVM--GEYADIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L  H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 ADAMNWDLNQHAVYAREGFTGEREAQTIGFATVRAGDIVGEHTAMFADIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR  FA+G++ AA W  +   GLY MRDVL +
Sbjct: 239 DRMTFAKGAVRAAKWLGANKAGLYDMRDVLNL 270


>gi|212634058|ref|YP_002310583.1| dihydrodipicolinate reductase [Shewanella piezotolerans WP3]
 gi|226724145|sp|B8CKF7|DAPB_SHEPW RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|212555542|gb|ACJ27996.1| Dihydrodipicolinate reductase [Shewanella piezotolerans WP3]
          Length = 271

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ GG GRMG+ LI+    N +I L + I R+GS L+G D G   G+  M +  +D+
Sbjct: 5   VRVAITGGSGRMGRTLIEAAKQNDAILLGAAIERAGSTLMGVDAGELAGVGAMNVAITDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF+SP  ++   +  A+H    +IGTTGF+  + E IS+++   PIV 
Sbjct: 65  LDKAVDDFDVLIDFTSPEASVIHTDWCAKHGKAIVIGTTGFNHAQKEQISAYSEQVPIVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NM++G+N +  L+E AAE +      D EI+E HHR K D+PSGTAL +GE IA    
Sbjct: 125 APNMAVGVNLMWKLLEVAAEVMGHYS--DIEIIEGHHRYKKDAPSGTALKMGEVIAETLG 182

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A  R  F
Sbjct: 183 RDLEKCAVYGREGITGERDRETIGFATVRAGDIVGEHTALFADIGERLEITHKASSRMTF 242

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W  +Q  GLY M+ VLG+
Sbjct: 243 ANGAMRAASWLSAQGSGLYDMQQVLGL 269


>gi|86147366|ref|ZP_01065679.1| dihydrodipicolinate reductase [Vibrio sp. MED222]
 gi|85834794|gb|EAQ52939.1| dihydrodipicolinate reductase [Vibrio sp. MED222]
          Length = 281

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 161/267 (60%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H+N   ++ +   R  S L+G DVG   G     +   D+
Sbjct: 14  VRIAIAGAAGRMGRNLVKAAHHNSEASVGAGSERPESSLVGVDVGELCGEGRFDVALVDD 73

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+ AI+  D I+DF++P  TL ++ +  +H    IIGTTGFS +E +VI + ++   IV 
Sbjct: 74  LSKAIEQFDVIVDFTAPVSTLANIELCKRHGKKLIIGTTGFSEEEKQVIDAASKEMAIVM 133

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 134 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 191

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V +R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 192 NELNDVAVWSREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 251

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 252 ANGAIKAAVWLNDKPAGFYTMTDVLGL 278


>gi|24346789|gb|AAN54210.1|AE015558_4 dihydrodipicolinate reductase [Shewanella oneidensis MR-1]
          Length = 281

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 159/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G GGRMG+ LI+  ++   I L + I R GS L+G D G   G+  + I   D+
Sbjct: 16  VRVAIVGAGGRMGRTLIESAYHQEHIRLGAAIERPGSSLVGVDAGELAGVGKLNIMIMDS 75

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A    D +IDF++P  ++  L+   +H    +IGTTGF+  + E I++FA   P+V 
Sbjct: 76  LDYATDDFDVLIDFTAPEASIVHLDWCVRHKKAMVIGTTGFNHAQKEQINAFAEQTPVVM 135

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 136 APNMSVGVNLMWKLLELAAEVM---GDYTDIEIIEGHHRYKKDAPSGTALKMGEVIAKTL 192

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 193 GRDLEKCAVYGREGITGERDRETIGFATVRAGDLVGEHTAMFADIGERLEITHKASSRMT 252

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 253 FANGAMRAAHWLVEQKPGLYDMQQVLGL 280


>gi|16763454|ref|NP_459069.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167989919|ref|ZP_02571019.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|197262001|ref|ZP_03162075.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|20978454|sp|Q8ZRX8|DAPB_SALTY RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|16418560|gb|AAL19028.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197240256|gb|EDY22876.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205331337|gb|EDZ18101.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261245298|emb|CBG23083.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267991727|gb|ACY86612.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301156696|emb|CBW16166.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911034|dbj|BAJ35008.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222367|gb|EFX47439.1| Dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323128382|gb|ADX15812.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332987016|gb|AEF05999.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 273

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     NL D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKNLKDCAVYSREGYTGERVAGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|229220630|ref|NP_716765.2| dihydrodipicolinate reductase [Shewanella oneidensis MR-1]
 gi|39931143|sp|Q8EHS7|DAPB_SHEON RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
          Length = 270

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 159/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G GGRMG+ LI+  ++   I L + I R GS L+G D G   G+  + I   D+
Sbjct: 5   VRVAIVGAGGRMGRTLIESAYHQEHIRLGAAIERPGSSLVGVDAGELAGVGKLNIMIMDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A    D +IDF++P  ++  L+   +H    +IGTTGF+  + E I++FA   P+V 
Sbjct: 65  LDYATDDFDVLIDFTAPEASIVHLDWCVRHKKAMVIGTTGFNHAQKEQINAFAEQTPVVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWKLLELAAEVM---GDYTDIEIIEGHHRYKKDAPSGTALKMGEVIAKTL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLEKCAVYGREGITGERDRETIGFATVRAGDLVGEHTAMFADIGERLEITHKASSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 242 FANGAMRAAHWLVEQKPGLYDMQQVLGL 269


>gi|22127568|ref|NP_670991.1| dihydrodipicolinate reductase [Yersinia pestis KIM 10]
 gi|45443431|ref|NP_994970.1| dihydrodipicolinate reductase [Yersinia pestis biovar Microtus str.
           91001]
 gi|51594973|ref|YP_069164.1| dihydrodipicolinate reductase [Yersinia pseudotuberculosis IP
           32953]
 gi|108810063|ref|YP_653979.1| dihydrodipicolinate reductase [Yersinia pestis Antiqua]
 gi|108810518|ref|YP_646285.1| dihydrodipicolinate reductase [Yersinia pestis Nepal516]
 gi|145600408|ref|YP_001164484.1| dihydrodipicolinate reductase [Yersinia pestis Pestoides F]
 gi|150260483|ref|ZP_01917211.1| dihydrodipicolinate reductase [Yersinia pestis CA88-4125]
 gi|162421157|ref|YP_001605360.1| dihydrodipicolinate reductase [Yersinia pestis Angola]
 gi|165927331|ref|ZP_02223163.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165937866|ref|ZP_02226427.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166008872|ref|ZP_02229770.1| dihydrodipicolinate reductase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212227|ref|ZP_02238262.1| dihydrodipicolinate reductase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401570|ref|ZP_02307064.1| dihydrodipicolinate reductase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422000|ref|ZP_02313753.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167426048|ref|ZP_02317801.1| dihydrodipicolinate reductase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167469831|ref|ZP_02334535.1| dihydrodipicolinate reductase [Yersinia pestis FV-1]
 gi|186893975|ref|YP_001871087.1| dihydrodipicolinate reductase [Yersinia pseudotuberculosis PB1/+]
 gi|218927678|ref|YP_002345553.1| dihydrodipicolinate reductase [Yersinia pestis CO92]
 gi|229836938|ref|ZP_04457103.1| dihydrodipicolinate reductase [Yersinia pestis Pestoides A]
 gi|229840367|ref|ZP_04460526.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842447|ref|ZP_04462602.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900706|ref|ZP_04515830.1| dihydrodipicolinate reductase [Yersinia pestis Nepal516]
 gi|270487925|ref|ZP_06204999.1| dihydrodipicolinate reductase [Yersinia pestis KIM D27]
 gi|294502576|ref|YP_003566638.1| dihydrodipicolinate reductase [Yersinia pestis Z176003]
 gi|20978453|sp|Q8ZIL6|DAPB_YERPE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|81640429|sp|Q66ER9|DAPB_YERPS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|123245371|sp|Q1C0I8|DAPB_YERPA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|123246765|sp|Q1CMU5|DAPB_YERPN RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166224188|sp|A4TQE9|DAPB_YERPP RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238687257|sp|A9R003|DAPB_YERPG RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238691376|sp|B2K3N1|DAPB_YERPB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|21960674|gb|AAM87242.1|AE013973_1 dihydrodipicolinate reductase [Yersinia pestis KIM 10]
 gi|45438300|gb|AAS63847.1| dihydrodipicolinate reductase [Yersinia pestis biovar Microtus str.
           91001]
 gi|51588255|emb|CAH19862.1| dihydrodipicolinate reductase [Yersinia pseudotuberculosis IP
           32953]
 gi|108774166|gb|ABG16685.1| dihydrodipicolinate reductase [Yersinia pestis Nepal516]
 gi|108781976|gb|ABG16034.1| dihydrodipicolinate reductase [Yersinia pestis Antiqua]
 gi|115346289|emb|CAL19160.1| dihydrodipicolinate reductase [Yersinia pestis CO92]
 gi|145212104|gb|ABP41511.1| dihydrodipicolinate reductase [Yersinia pestis Pestoides F]
 gi|149289891|gb|EDM39968.1| dihydrodipicolinate reductase [Yersinia pestis CA88-4125]
 gi|162353972|gb|ABX87920.1| dihydrodipicolinate reductase [Yersinia pestis Angola]
 gi|165914278|gb|EDR32894.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165920793|gb|EDR38041.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165992211|gb|EDR44512.1| dihydrodipicolinate reductase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206973|gb|EDR51453.1| dihydrodipicolinate reductase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960137|gb|EDR56158.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167048952|gb|EDR60360.1| dihydrodipicolinate reductase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054971|gb|EDR64771.1| dihydrodipicolinate reductase [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|186697001|gb|ACC87630.1| dihydrodipicolinate reductase [Yersinia pseudotuberculosis PB1/+]
 gi|229682045|gb|EEO78137.1| dihydrodipicolinate reductase [Yersinia pestis Nepal516]
 gi|229690757|gb|EEO82811.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696733|gb|EEO86780.1| dihydrodipicolinate reductase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229705881|gb|EEO91890.1| dihydrodipicolinate reductase [Yersinia pestis Pestoides A]
 gi|262360606|gb|ACY57327.1| dihydrodipicolinate reductase [Yersinia pestis D106004]
 gi|262364552|gb|ACY61109.1| dihydrodipicolinate reductase [Yersinia pestis D182038]
 gi|270336429|gb|EFA47206.1| dihydrodipicolinate reductase [Yersinia pestis KIM D27]
 gi|294353035|gb|ADE63376.1| dihydrodipicolinate reductase [Yersinia pestis Z176003]
 gi|320016958|gb|ADW00530.1| dihydrodipicolinate reductase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 273

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 161/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+++G GGRMG+ LI+ +     + L + I R GS L+G D G   G+  + +
Sbjct: 1   MTDSTIRIAIVGAGGRMGRQLIQAVTQMEGVVLGAAIERKGSTLVGSDAGELAGVGLLNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+L+    + D +IDF+ P  TL+ L I  QH    +IGTTGF       IS  A +
Sbjct: 61  IVGDDLSQLTDNFDVLIDFTRPEGTLEHLAICRQHRKAMVIGTTGFDEAGKAAISEAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADAMGRSLKDCAVYSREGYTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W      GL+ MRDVL +
Sbjct: 238 TSRMTFAHGAVKSAIWLGKHDNGLFDMRDVLNL 270


>gi|292489401|ref|YP_003532288.1| dihydrodipicolinate reductase [Erwinia amylovora CFBP1430]
 gi|292898380|ref|YP_003537749.1| dihydrodipicolinate reductase [Erwinia amylovora ATCC 49946]
 gi|291198228|emb|CBJ45334.1| dihydrodipicolinate reductase [Erwinia amylovora ATCC 49946]
 gi|291554835|emb|CBA22702.1| Dihydrodipicolinate reductase [Erwinia amylovora CFBP1430]
          Length = 273

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 156/272 (57%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +RI+++G  GRMG+ LI+         L + +VRSGS L+G D G   G   +GI
Sbjct: 1   MSNAEIRIAIVGAAGRMGRQLIQATEQAEGARLGAALVRSGSSLVGSDAGELAGCGALGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +DNL       D +IDF+ P  TL  L    QH    +IGTTGF       I + A+ 
Sbjct: 61  TITDNLEAVANDFDVLIDFTRPQATLHYLAFCRQHQKTMVIGTTGFDDAGKAAIEAAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  LVE AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNLVLKLVEKAAKVM--GEYADIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L  H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 ADAMNWDLNQHAVYAREGFTGEREAQTIGFATVRAGDIVGEHTAMFADIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR  FA+G++ AA W  +   GLY MRDVL +
Sbjct: 239 DRMTFAKGAVRAAKWLGANKAGLYGMRDVLNL 270


>gi|127513768|ref|YP_001094965.1| dihydrodipicolinate reductase [Shewanella loihica PV-4]
 gi|166224173|sp|A3QGV8|DAPB_SHELP RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|126639063|gb|ABO24706.1| dihydrodipicolinate reductase [Shewanella loihica PV-4]
          Length = 271

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 167/278 (60%), Gaps = 25/278 (8%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ GG GRMG+ LI+    + +I L + + R+GS LIG D G   G+  M +  +D+
Sbjct: 5   VRVAITGGSGRMGRTLIESAKLSSNIYLGAAVERAGSTLIGVDAGELAGVGAMNVAITDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF+SP  ++   +  +++    +IGTTGF+  + E I+++A N PIV 
Sbjct: 65  LDNAVDDFDILIDFTSPEASVVHTDWCSRNGKAIVIGTTGFNHAQKEQIAAYAENTPIVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWRLLELAAEVM---GDYTDIEIIEGHHRHKKDAPSGTALKMGEVIAE-- 179

Query: 184 KVNLTDHMVLNRHIQQCA----------RTEGSIGIASLRAGSIVGEHSVVIAGEGESIT 233
                   VL R +++CA          R+  +IG +++RAG +VGEH+ + A  GE + 
Sbjct: 180 --------VLGRDLEKCAVYGREGITEERSRETIGFSTIRAGDLVGEHTAMFADIGERLE 231

Query: 234 LSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ++H A  R  FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 232 ITHKASSRMTFANGAMRAAFWLGDQGPGLYDMQQVLGL 269


>gi|262044927|ref|ZP_06017969.1| dihydrodipicolinate reductase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259037654|gb|EEW38883.1| dihydrodipicolinate reductase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 273

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 156/271 (57%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALQMEGVALGAALEREGSSLVGSDAGELAGAGKAGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +LA      D +IDF+ P  TL  L    +H    +IGTTGF     + I   A++
Sbjct: 61  AVQSSLAAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTTGFDDAGKQAIRDAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALNKDLKDCAVFSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLKGKKNGLFDMRDVL 268


>gi|238893015|ref|YP_002917749.1| dihydrodipicolinate reductase [Klebsiella pneumoniae NTUH-K2044]
 gi|238545331|dbj|BAH61682.1| dihydrodipicolinate reductase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|238774018|dbj|BAH66515.1| dihydrodipicolinate reductase [Klebsiella pneumoniae NTUH-K2044]
          Length = 273

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 156/271 (57%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALQMEGVALGAALEREGSSLVGSDAGELAGAGKAGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +LA      D +IDF+ P  TL  L    +H    +IGTTGF     + I   A++
Sbjct: 61  AVQSSLAAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTTGFDDAGKQAIRDAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALNKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLKDKKNGLFDMRDVL 268


>gi|168230325|ref|ZP_02655383.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168243541|ref|ZP_02668473.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168464402|ref|ZP_02698305.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168820966|ref|ZP_02832966.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445308|ref|YP_002039295.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450677|ref|YP_002044031.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194469330|ref|ZP_03075314.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197251291|ref|YP_002145047.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|200388138|ref|ZP_03214750.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|226696358|sp|B5F744|DAPB_SALA4 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238690660|sp|B4TIG4|DAPB_SALHS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238693627|sp|B4T6J1|DAPB_SALNS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|194403971|gb|ACF64193.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194408981|gb|ACF69200.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194455694|gb|EDX44533.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|195632591|gb|EDX51045.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197214994|gb|ACH52391.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|199605236|gb|EDZ03781.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205334926|gb|EDZ21690.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337502|gb|EDZ24266.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205342377|gb|EDZ29141.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320084300|emb|CBY94093.1| Dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 273

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     NL D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|256548853|gb|ACU82908.1| dihydrodipicolinate reductase [Buchnera aphidicola (Acyrthosiphon
           kondoi)]
          Length = 269

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 105/264 (39%), Positives = 160/264 (60%), Gaps = 3/264 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI + G  GRMGQ LIKEI  N    L + +V+    LIG+D+G  +GI  M +  +D L
Sbjct: 6   RIVITGAMGRMGQMLIKEIKKNEQTCLTAALVKKNCQLIGKDIGEILGIGKMDVLINDEL 65

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
            M  +  D +IDF++   TL+ L   ++     +IGTTGFS +E ++I S++++  I+ S
Sbjct: 66  NMNKKDFDVLIDFTNTNSTLKYLEYCSKFKKNIVIGTTGFSSEEMDIIKSYSQDIAIIIS 125

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           SN S+GIN L  L+E   + +   K  D +ILE HHR K+D+PSGTAL +GE I+     
Sbjct: 126 SNFSIGINLLFQLIEKTTQII--GKSSDIDILEYHHRNKIDAPSGTALAIGEVISKVMNW 183

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L  H + ++      R    IG + +RAG+I+G+H+V+ +  GE I ++H+A DR  FA
Sbjct: 184 DLNKHSIYHKKGITGIRERKKIGFSIVRAGNIIGKHTVMFSSSGEEIKITHTASDRISFA 243

Query: 246 RGSLTAALWAKSQIPGLYSMRDVL 269
           +G++ +ALW   +  GL+ M DVL
Sbjct: 244 KGAIQSALWIHKKKMGLFDMSDVL 267


>gi|269137949|ref|YP_003294649.1| hypothetical protein ETAE_0591 [Edwardsiella tarda EIB202]
 gi|267983609|gb|ACY83438.1| hypothetical protein ETAE_0591 [Edwardsiella tarda EIB202]
 gi|304557998|gb|ADM40662.1| Dihydrodipicolinate reductase [Edwardsiella tarda FL6-60]
          Length = 272

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 151/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G GGRMG+ LI      P +TL + + R GS L+G D G   G    G+    +
Sbjct: 5   IRVAIAGAGGRMGRQLIAATAAIPGVTLGAALEREGSSLLGCDAGELAGCGITGVTVESS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  T+  L     H    +IGTTGFS +E   I + +++  IV 
Sbjct: 65  LERVAGQFDVLIDFTRPEGTMAHLAFCQAHGKAMVIGTTGFSEQEKATIEAASQHIAIVL 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N +  L+E AA+ +      D EILE HHR K+D+PSGTAL +GEAIA    
Sbjct: 125 AANFSVGVNVMLRLLEKAAQVM--GSYCDIEILEAHHRHKVDAPSGTALAMGEAIAGALG 182

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L    V  R      R  GSIG A+LRAG IVGEH+ + A  GE + ++H A  R  F
Sbjct: 183 RRLESCAVYTRQGHTGERVPGSIGFATLRAGDIVGEHTALFADVGERLEITHKASSRMTF 242

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AALW  +Q PG+Y M DVL +
Sbjct: 243 ASGAMRAALWLGAQQPGMYDMCDVLAL 269


>gi|56412337|ref|YP_149412.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361274|ref|YP_002140909.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81599594|sp|Q5PIL9|DAPB_SALPA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238690791|sp|B5BL41|DAPB_SALPK RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|56126594|gb|AAV76100.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197092749|emb|CAR58172.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 273

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 155/272 (56%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM--GYYSDIEIIEAHHRHKVDAPSGTALEMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     NL D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 AGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G+L AALW K++  GL+ MRDVLG+
Sbjct: 239 SRMTFANGALRAALWLKTKKNGLFDMRDVLGL 270


>gi|152968620|ref|YP_001333729.1| dihydrodipicolinate reductase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|166222640|sp|A6T4H8|DAPB_KLEP7 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|150953469|gb|ABR75499.1| dihydrodipicolinate reductase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 273

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 156/271 (57%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALQMEGVALGAALEREGSSLVGSDAGELAGAGKAGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +LA      D +IDF+ P  TL  L    +H    +IGTTGF     + I   A++
Sbjct: 61  AVQSSLAAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTTGFDDAGKQAIRDAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALNKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLKGKKNGLFDMRDVL 268


>gi|238782680|ref|ZP_04626710.1| Dihydrodipicolinate reductase [Yersinia bercovieri ATCC 43970]
 gi|238716340|gb|EEQ08322.1| Dihydrodipicolinate reductase [Yersinia bercovieri ATCC 43970]
          Length = 273

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 161/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + R GS L+G D G   G   +GI
Sbjct: 1   MTNSTIRIAVVGAGGRMGRQLIQAITQTDGVVLGAAVERVGSTLVGSDAGELAGTGLLGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L   I   D +IDF+ P  TL  L I  QH    +IGTTGF       IS+ A +
Sbjct: 61  AVSDDLLSVIDHFDVLIDFTRPEGTLVHLAICRQHRKAMVIGTTGFDDAGKAAISAAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L DH V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADSLGWSLKDHAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W      G + MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWVSEHDNGQFDMRDVLNL 270


>gi|90022375|ref|YP_528202.1| dihydrodipicolinate reductase [Saccharophagus degradans 2-40]
 gi|123276490|sp|Q21H39|DAPB_SACD2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|89951975|gb|ABD81990.1| dihydrodipicolinate reductase [Saccharophagus degradans 2-40]
          Length = 268

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 152/266 (57%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V G  GRMG+ALI+ +  +    L + IV   S L+G D G   G+   G+   ++L
Sbjct: 4   RIAVTGAAGRMGKALIEAVCQSEDAVLGAAIVAPDSSLVGADAGELAGVGKQGVAIVNDL 63

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           +  +   D +IDF+SP+ T+ + ++   HN   ++GTTGFS  E     + A   P   +
Sbjct: 64  STVVADFDVLIDFTSPSATVANASVCKAHNKPMVVGTTGFSPAEKAAFEADASTVPTCVA 123

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           SN S G+N    L++ AA  +    D D E+ E HHR K+D+PSGTAL +GE +AN    
Sbjct: 124 SNFSTGVNLCFKLLDIAARVM--GNDADIEVYEAHHRHKVDAPSGTALRMGEVLANAVNR 181

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L +  V  R  Q  AR   +IG A++R G +VG+H+V    EGE + ++H A  R  FA
Sbjct: 182 DLNEVAVYGREGQTGARDRNTIGFATVRGGDVVGDHTVSFMCEGERVEITHKASSRLSFA 241

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG++ AA W   + P +Y M+DVLG+
Sbjct: 242 RGAVRAATWLVEKEPKIYDMQDVLGL 267


>gi|238797498|ref|ZP_04640996.1| Dihydrodipicolinate reductase [Yersinia mollaretii ATCC 43969]
 gi|238718639|gb|EEQ10457.1| Dihydrodipicolinate reductase [Yersinia mollaretii ATCC 43969]
          Length = 273

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/273 (41%), Positives = 164/273 (60%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M+ S +RI+V+G GGRMG+ LI+ I    S+ L + + R GS L+G D G   G   +GI
Sbjct: 1   MNNSTIRIAVVGAGGRMGRQLIQAITQTESVVLGAAVERVGSTLVGSDAGELAGTGLLGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L+  I   D +IDF+ P  TL+ L I  QH    +IGTTGF       IS+ A +
Sbjct: 61  TVSDDLSKVIDHFDVLIDFTRPEGTLEHLAICRQHRKAMVIGTTGFDDAGKAAISAAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L +  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADSLGWSLNECAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W      G + MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWVSEYDNGQFDMRDVLNL 270


>gi|330807470|ref|YP_004351932.1| dihydrodipicolinate reductase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375578|gb|AEA66928.1| Dihydrodipicolinate reductase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 268

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 159/265 (60%), Gaps = 4/265 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHN-NPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+AL++ +   +P   L + IVR  S L+G D G    +  +G+  S  
Sbjct: 3   RIAVMGAAGRMGKALVEAVQQRSPLSGLTAAIVRPDSTLVGADAGELASLGRIGVPMSGG 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+ P + L++L I  +H    +IGTTG    + ++++   ++ PIV 
Sbjct: 63  LEKVLDEFDVLIDFTLPEVMLKNLAICRKHGKAMVIGTTGLDAGQKQLLADAGKDIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE IA+   
Sbjct: 123 AANFSVGVNLSLKLLDMAARVL--GDDADIEIIEAHHRHKIDAPSGTALRMGEVIADALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R     AR   +IG A++R G +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLQEVAVYGRQGHTGARERSTIGFATVRGGDVVGDHTVLFATEGERLEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AALW   + PGLY M+DVL
Sbjct: 241 AKGAVRAALWLDGREPGLYDMQDVL 265


>gi|33152467|ref|NP_873820.1| dihydrodipicolinate reductase [Haemophilus ducreyi 35000HP]
 gi|39931013|sp|Q7VLM6|DAPB_HAEDU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|33148690|gb|AAP96209.1| dihydrodipicolinate reductase [Haemophilus ducreyi 35000HP]
          Length = 269

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 155/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+++G GGRMG+ LI+ +     ++L +   R GS LIG DVG  VGISP+GI  S  
Sbjct: 2   LRIAIVGAGGRMGRNLIQAVQQTEGLSLMAAFEREGSSLIGTDVGELVGISPLGITISAC 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D +IDF+ P  TL+ L     ++   +IGTTGF     + I   ++   IV 
Sbjct: 62  LAEKTADFDVLIDFTRPEATLEYLKFCLANDKKIVIGTTGFDENGKQAIKQASQKIAIVF 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SN S+G+N +  L+E AA+ +      D EI+E HH+ K+D+PSGTAL +GE IA    
Sbjct: 122 ASNYSVGVNLVFKLLEKAAKVM--GNYCDIEIIEAHHKHKVDAPSGTALSMGEHIAKTLG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R+     R    IG A++RAG IVGEHSV    EGE + +SH A  R  F
Sbjct: 180 RDLKTDAVFERYGIMDERQTNQIGFATIRAGDIVGEHSVWFVDEGERVEISHKATSRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W  +Q  GL+ M +VL +
Sbjct: 240 AKGAVCAAQWLANQPQGLFDMTNVLAL 266


>gi|290474748|ref|YP_003467628.1| dihydrodipicolinate reductase [Xenorhabdus bovienii SS-2004]
 gi|289174061|emb|CBJ80848.1| dihydrodipicolinate reductase [Xenorhabdus bovienii SS-2004]
          Length = 273

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 159/272 (58%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R++V+G GGRMG+ LI+        TL + + RSGS L+G D G   GI   GI
Sbjct: 1   MADTDIRVAVVGAGGRMGRHLIQAAQQLDGATLGAALERSGSSLVGTDAGELAGIGKNGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L   I+  D +IDF+ P  TL  L I  Q+    +IGTTGF     + I   +R+
Sbjct: 61  TVSDDLHDVIEHFDVLIDFTRPEGTLAYLAICRQYRKAIVIGTTGFDDAGKQAIEDASRD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA  +   +  D EI+E HHR K+D+PSGTAL +GE+I
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAATVM--GEYTDIEIIEAHHRHKVDAPSGTALAMGESI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + +SH A 
Sbjct: 179 AHALGRDLKTCGVYAREGHTGERDPKSIGFATVRAGDIVGEHTAIFADIGERVEISHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G++ AA+W  ++   LY M+DVL +
Sbjct: 239 SRMTFANGAIKAAIWLNAKNNDLYDMKDVLNL 270


>gi|209694176|ref|YP_002262104.1| dihydrodipicolinate reductase [Aliivibrio salmonicida LFI1238]
 gi|226696348|sp|B6ENC8|DAPB_ALISL RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|208008127|emb|CAQ78269.1| dihydrodipicolinate reductase [Aliivibrio salmonicida LFI1238]
          Length = 269

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/265 (41%), Positives = 156/265 (58%), Gaps = 3/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G  GRMG+ LIK ++ +    L +      S LIG DVG   G+   GI   D+
Sbjct: 2   VRVAIAGAAGRMGRNLIKAVNGSQYAVLAAASEHPESSLIGVDVGEMAGLGKSGIVIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA A+   D IIDF+ P  TL+++ +  +HN   +IGTTGFS    E+I   A+  PIV 
Sbjct: 62  LAKAVDDFDVIIDFTLPISTLKNIELCQEHNKAIVIGTTGFSEPGKELIDQAAKEIPIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNVVFKLLEKAAKIM--GDYCDIEIIEAHHRYKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      RT+  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLDDVAVYTREGITGERTKNEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A G++ A+ W   + PG Y+M DVL
Sbjct: 240 ANGAVRASHWLHQKSPGFYTMHDVL 264


>gi|157962894|ref|YP_001502928.1| dihydrodipicolinate reductase [Shewanella pealeana ATCC 700345]
 gi|189082806|sp|A8H756|DAPB_SHEPA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|157847894|gb|ABV88393.1| Dihydrodipicolinate reductase [Shewanella pealeana ATCC 700345]
          Length = 274

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 157/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ GG GRMG+ LI+    N  I L + I R+GS L+G D G   G+  M +  +D+
Sbjct: 5   VRVAITGGSGRMGRTLIEAAKQNELILLGAAIERAGSTLMGVDAGELAGVGAMNVAITDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF+SP  ++   +  A++    +IGTTGF+  + E IS++    PIV 
Sbjct: 65  LDKAVDDFDVLIDFTSPEASVVHTDWCARNGKAIVIGTTGFNHAQKEQISAYGDQIPIVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NM++G+N +  L+E AAE +      D EI+E HHR K D+PSGTAL +GE IA    
Sbjct: 125 APNMAVGVNLMWKLLEVAAEVM--GDYCDIEIIEGHHRYKKDAPSGTALKMGEVIAETLG 182

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A  R  F
Sbjct: 183 RDLEKCAVYGREGITGERDRGTIGFATVRAGDIVGEHTALFADIGERLEITHKASSRMTF 242

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W   Q  GLY M+ VLG+
Sbjct: 243 ANGAMRAATWLVEQDAGLYDMQQVLGL 269


>gi|91792354|ref|YP_562005.1| dihydrodipicolinate reductase [Shewanella denitrificans OS217]
 gi|123166364|sp|Q12QJ4|DAPB_SHEDO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|91714356|gb|ABE54282.1| dihydrodipicolinate reductase [Shewanella denitrificans OS217]
          Length = 270

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/269 (40%), Positives = 156/269 (57%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + +R++V+G  GRMG+ LI+   +   ITL + I R GS LIG D G   G+  + +   
Sbjct: 3   TKVRVAVVGASGRMGRVLIEAAKHQDVITLGAAIERQGSTLIGADAGELAGVGCVNVAIC 62

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+L       D +IDF+SP  ++  L    +H    +IGTTGF+  + E IS+ A   P+
Sbjct: 63  DSLDNVKDDFDVLIDFTSPDASMLHLEWCLRHKKPMVIGTTGFNHAQKEQISACAEQIPV 122

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V S NMS+G+N +  L+E A   +   +D D EI+E HHR K D+PSGTAL +GE IAN 
Sbjct: 123 VFSPNMSVGVNLMWKLLEVATAVM--GQDTDIEIIEAHHRHKKDAPSGTALKMGEIIANT 180

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R     AR   +IG +++RAG IVGEH+ + A  GE I ++H A  R 
Sbjct: 181 LGRDLEECAVYGREGITGARDRNTIGFSTIRAGDIVGEHTAMFADIGERIEITHKASSRM 240

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A G++ AA W   Q  GLY M+ VLG+
Sbjct: 241 TYANGAMRAAFWLYDQNAGLYDMQQVLGL 269


>gi|113969308|ref|YP_733101.1| dihydrodipicolinate reductase [Shewanella sp. MR-4]
 gi|114046508|ref|YP_737058.1| dihydrodipicolinate reductase [Shewanella sp. MR-7]
 gi|123325273|sp|Q0HLM3|DAPB_SHESM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|123326787|sp|Q0HY04|DAPB_SHESR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|113883992|gb|ABI38044.1| dihydrodipicolinate reductase [Shewanella sp. MR-4]
 gi|113887950|gb|ABI42001.1| dihydrodipicolinate reductase [Shewanella sp. MR-7]
          Length = 270

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/268 (39%), Positives = 159/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G GGRMG+ LI+  ++   I L + I R GS L+G D G   G+  + +   D+
Sbjct: 5   VRVAIVGAGGRMGRTLIESAYHQEHIRLGAAIERPGSSLVGVDAGELAGVGKLNVLVMDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A    D +IDF++P  ++  L+   +H    +IGTTGF+  + E I++FA   P+V 
Sbjct: 65  LDYATDDFDVLIDFTAPEASIVHLDWCVRHKKAMVIGTTGFNHAQKEQINAFAEQTPVVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWKLLELAAEVM---GDYTDIEIIEGHHRHKKDAPSGTALKMGEVIAKTL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLEKCAVYGREGITGERDRETIGFATVRAGDLVGEHTAMFADIGERLEITHKASSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 242 FANGAMRAAHWLVEQKPGLYDMQQVLGL 269


>gi|89091968|ref|ZP_01164923.1| dihydrodipicolinate reductase [Oceanospirillum sp. MED92]
 gi|89083703|gb|EAR62920.1| dihydrodipicolinate reductase [Oceanospirillum sp. MED92]
          Length = 268

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 160/267 (59%), Gaps = 2/267 (0%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++++V G  GRMG+A I+ +     I L + IV   S LIG D G   G+  +G+    +
Sbjct: 2   IKVAVTGAAGRMGKANIEALQMAEGIELGAAIVEPDSSLIGVDAGEMAGVGKLGVSVVGS 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF++P +TL+++     H    +IGTTG + ++   +   A  + IV 
Sbjct: 62  LHEAVADFDVLIDFTAPEVTLENVRFCNTHGKKIVIGTTGLTDEQKTHLDKAAETSAIVF 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L    D+D E++E HHR K+DSPSGTAL +GE +A+   
Sbjct: 122 APNMSVGVNLCFKLLEVAAKAL-GNDDYDIEVIEAHHRHKVDSPSGTALRMGEVVADALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R     AR  G IG  ++RAG +VG+H+V+ A EGE I ++H A +R  F
Sbjct: 181 RDLKECAVYGREGMTGARPRGEIGFETIRAGDVVGDHTVLFATEGERIEITHKASNRLTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W + Q  GLY M+D+LG+
Sbjct: 241 AKGAVRAAKWVQGQETGLYDMQDILGL 267


>gi|238911124|ref|ZP_04654961.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 273

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 158/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D +IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVLIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|329847450|ref|ZP_08262478.1| dihydrodipicolinate reductase [Asticcacaulis biprosthecum C19]
 gi|328842513|gb|EGF92082.1| dihydrodipicolinate reductase [Asticcacaulis biprosthecum C19]
          Length = 251

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 156/279 (55%), Gaps = 36/279 (12%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M     R +V G  GRMGQA+IK +      T H+                      M  
Sbjct: 1   MAAPATRFAVNGYKGRMGQAVIKVLDE----TKHT----------------------MSA 34

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNI------VHIIGTTGFSVKENEVI 113
           K+       +   D +IDFS+P  +L  L   A   +      VH+IG+TGF+ ++ + +
Sbjct: 35  KYEKGDMFDLTRTDAVIDFSTPEASLSLLEACAGEGLARPRPLVHVIGSTGFTPEQRDEL 94

Query: 114 SSFARNAPIVKSSNMSLGINFL-GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTA 172
             FA    I++S N SLG+N L G L + AA   L A+DWD EI+E HHRRK+D+PSGTA
Sbjct: 95  IRFADEVVIIQSGNFSLGVNLLMGLLKQAAAR--LAAEDWDIEIVEAHHRRKVDAPSGTA 152

Query: 173 LLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESI 232
           L+LGEA A GR V L +  V  R     AR  G IG + +R G IVGEHS V+A E E +
Sbjct: 153 LMLGEAAAYGRNVRLDEVKVAARDGITGARRAGDIGFSVIRGGGIVGEHSAVLASEDEIL 212

Query: 233 TLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           TLSHSA DR +FARG++ AALW ++Q  G Y M+DVLG+
Sbjct: 213 TLSHSARDRTLFARGAIQAALWGRTQKAGFYDMQDVLGL 251


>gi|207855579|ref|YP_002242230.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|226696360|sp|B5R1Q4|DAPB_SALEP RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|206707382|emb|CAR31655.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 273

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGGGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     NL D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|238774050|dbj|BAH66546.1| dihydrodipicolinate reductase [Klebsiella pneumoniae]
          Length = 273

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 155/271 (57%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L   + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAAMQMEGVALGVALEREGSSLVGSDAGELAGAGKAGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +LA      D +IDF+ P  TL  L    +H    +IGTTGF     + I   A++
Sbjct: 61  AVQSSLAAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTTGFDDAGKQAIRDAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALNKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLKGKKNGLFDMRDVL 268


>gi|254362926|ref|ZP_04978993.1| dihydrodipicolinate reductase [Mannheimia haemolytica PHL213]
 gi|153094572|gb|EDN75389.1| dihydrodipicolinate reductase [Mannheimia haemolytica PHL213]
          Length = 270

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 154/266 (57%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI+ +HN   + L S   R GS L+G D G   G+  +G+  SD
Sbjct: 2   TLKIGIVGAGGRMGRQLIQAVHNAQGVELGSAFERKGSSLVGSDAGEVAGVGTLGVVISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           ++A  +   D +IDF+ P  TL+ L+I   H+   +IGTTGF       I + +    IV
Sbjct: 62  DVAQNVAGFDLLIDFTRPEGTLEHLDICVAHHKQMVIGTTGFDDAGKAAIKAASEKIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R+     R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 180 GRDLKTHGVFERNGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W   +  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLNGKQNGLFDMTDVL 265


>gi|261492069|ref|ZP_05988643.1| dihydrodipicolinate reductase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496822|ref|ZP_05993194.1| dihydrodipicolinate reductase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307505|gb|EEY08836.1| dihydrodipicolinate reductase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261312270|gb|EEY13399.1| dihydrodipicolinate reductase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 270

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 154/266 (57%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI+ +HN   + L S   R GS L+G D G   G+  +G+  SD
Sbjct: 2   TLKIGIVGAGGRMGRQLIQAVHNAQGVELGSAFERKGSSLVGSDTGEVAGVGTLGVVISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           ++A  +   D +IDF+ P  TL+ L+I   H+   +IGTTGF       I + +    IV
Sbjct: 62  DVAQNVAGFDLLIDFTRPEGTLEHLDICVAHHKQMVIGTTGFDDAGKAAIKAASEKIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R+     R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 180 GRDLKTHGVFERNGITGERKHDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W   +  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLNGKQNGLFDMTDVL 265


>gi|300724592|ref|YP_003713917.1| dihydrodipicolinate reductase [Xenorhabdus nematophila ATCC 19061]
 gi|297631134|emb|CBJ91825.1| dihydrodipicolinate reductase [Xenorhabdus nematophila ATCC 19061]
          Length = 273

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/272 (40%), Positives = 158/272 (58%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +RI+++G  GRMG++LI+ I     +TL + +  SGS L+G D G   GI   GI
Sbjct: 1   MTDTDIRIAIVGASGRMGRSLIQAIQPLNGVTLGAALEHSGSSLVGTDAGELAGIGKNGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+L   I+  D +IDF+ P  TL  L I  Q+    +IGTTGF       I   +R 
Sbjct: 61  IICDDLHHVIEHFDVLIDFTRPEGTLAYLAICRQYRKSMVIGTTGFDEAGKHAIEEASRE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA  +   +  D EI+E HHR K+D+PSGTAL +GE+I
Sbjct: 121 IPIVFAANFSVGVNLILKLLEKAATVM--GEYTDIEIIEAHHRHKVDAPSGTALAMGESI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           AN    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + +SH A 
Sbjct: 179 ANALGRDLKTCAVYAREGHTGERDPNSIGFATIRAGDIVGEHTAIFADIGERVEISHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G++ +A+W   +  GLY+M+DVL +
Sbjct: 239 SRMTFANGAVKSAIWLTDKNSGLYNMKDVLNL 270


>gi|304413770|ref|ZP_07395214.1| dihydrodipicolinate reductase [Candidatus Regiella insecticola
           LSR1]
 gi|304283861|gb|EFL92255.1| dihydrodipicolinate reductase [Candidatus Regiella insecticola
           LSR1]
          Length = 265

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 161/265 (60%), Gaps = 5/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ LI+    +  +TL +  VR     +G D G  V I+P+ I  SDN
Sbjct: 2   IRIAIAGAAGRMGKQLIQATAQHNQVTLTAAFVRQNDAAVGMDAGVLVDINPLNITLSDN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA    + D +IDF++P  TLQ L    Q     +IGTTGFS ++   I+  A    I++
Sbjct: 62  LAAIEDNFDVLIDFTTPTATLQHLEYCRQQKKAMVIGTTGFSDQDKIRINQAAEEIAIIR 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N +  L++  A+ +   KD D EI+E HHR K+D+PSGTAL +GEA+A+   
Sbjct: 122 AANFSVGVNLMLELLKKTAKII--GKDTDIEIIEAHHRHKVDAPSGTALAMGEALADTLG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           ++L    +  R+ +   R  G+IG ++LRAG+I+GEH V+ A + E +T++H A  R  F
Sbjct: 180 LDLKQAALYCRNKE--PRKPGTIGFSTLRAGNIIGEHQVLFANDDEQLTITHKANSRMTF 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A G++ AA+W   +  GL+ M +VL
Sbjct: 238 ANGAIRAAIWLTRKQKGLFDMSNVL 262


>gi|153948962|ref|YP_001402410.1| dihydrodipicolinate reductase [Yersinia pseudotuberculosis IP
           31758]
 gi|167012024|sp|A7FMD2|DAPB_YERP3 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|152960457|gb|ABS47918.1| dihydrodipicolinate reductase [Yersinia pseudotuberculosis IP
           31758]
          Length = 273

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 160/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+++G GGRMG+ LI+ +     + L + I R GS L+G D G   G+  + +
Sbjct: 1   MTDSTIRIAIVGAGGRMGRQLIQAVTQMEGVVLGAAIERKGSTLVGSDAGELAGVGLLNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+L+    + D +IDF+ P  TL+ L I  QH    +IGTTGF       IS  A +
Sbjct: 61  IVGDDLSQLTDNFDVLIDFTRPEGTLEHLAICRQHRKAMVIGTTGFDEAGKAAISEAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADAMGRSLKDCAVYSREGYTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ + +W      GL+ MRDVL +
Sbjct: 238 TSRMTFAHGAVKSTIWLGKHDNGLFDMRDVLNL 270


>gi|148262318|ref|YP_001229024.1| dihydrodipicolinate reductase [Geobacter uraniireducens Rf4]
 gi|189082796|sp|A5GD90|DAPB_GEOUR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|146395818|gb|ABQ24451.1| dihydrodipicolinate reductase [Geobacter uraniireducens Rf4]
          Length = 267

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 164/271 (60%), Gaps = 11/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMG  +I  I       +   + R G P++GQD G   G+  +G+  SD+
Sbjct: 2   VKIAVCGAAGRMGGRIIAAISETEGAVVSGALERLGHPMVGQDAGFNAGLGAIGVTISDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +Q  D +IDF++P ++L++L +   +    +IG+TGF+ +E  + +  A++ P+V 
Sbjct: 62  LTAVVQGCDVLIDFTTPKVSLKNLEVCGLNKKSIVIGSTGFTPEERALAAELAKDIPVVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    ++   A+ L    D+D EI+E HH+ K DSPSGTA+ +GE +A   G
Sbjct: 122 APNMSVGVNVCFKVLADVAKIL--GDDFDVEIVEAHHKMKKDSPSGTAVRMGEVVAEALG 179

Query: 183 RKVNLTDHMVLNRHIQQ-CA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT+  IG+ ++R G IVGEH+V   G GE I ++H A+ 
Sbjct: 180 RDYN----KVANFHREGICGERTKDEIGMQTIRGGDIVGEHTVYFIGMGERIEITHRAHT 235

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RGS+ AA W  SQ PGLY M+DVLG+
Sbjct: 236 RDMFSRGSVRAAKWVVSQKPGLYDMQDVLGL 266


>gi|221213183|ref|ZP_03586158.1| dihydrodipicolinate reductase [Burkholderia multivorans CGD1]
 gi|221166635|gb|EED99106.1| dihydrodipicolinate reductase [Burkholderia multivorans CGD1]
          Length = 265

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 166/267 (62%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    G+K +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPSLGQDAGAFLG-KDTGVKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  +  + +H++  +IGTTGF+ ++  V+ + A    IV 
Sbjct: 60  IDAVFAQADYLIDFTRPEGTLAHVEAALRHDVKLVIGTTGFTAEQKAVLHAAAEKVAIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKIDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARDTGLFDMQDVLGL 264


>gi|163750812|ref|ZP_02158047.1| dihydrodipicolinate reductase [Shewanella benthica KT99]
 gi|161329507|gb|EDQ00501.1| dihydrodipicolinate reductase [Shewanella benthica KT99]
          Length = 270

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 162/268 (60%), Gaps = 5/268 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ GG GRMG+ LI+     P+I L + I R+GS LIG D G   G+  M +   D+
Sbjct: 5   VRVAITGGSGRMGRTLIEAARIQPAIYLGAAIERAGSTLIGVDAGELAGVGAMNVPIIDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   + + D +IDF+SP  ++   +  A+H    +IGTTGF+  + E IS++A+  PIV 
Sbjct: 65  LDKTVDAFDVLIDFTSPEASVNHADWCARHAKAIVIGTTGFTDAQKEQISTYAKQIPIVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NM++G+N +  L+E  A+ +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMAVGVNLMWKLLELTAKVM---GDYTDIEIIEGHHRYKKDAPSGTALKMGEVIAKTL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG +++RAG +VGEH+V+ A  GE + ++H A  R  
Sbjct: 182 GRDLKKCAVYGREGMIGERDRETIGFSTIRAGDLVGEHTVMFADIGERLEITHKATSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ A++W  +Q  GLY M+ VLG+
Sbjct: 242 FANGAMRASVWLVNQDAGLYDMQQVLGL 269


>gi|325528363|gb|EGD05511.1| dihydrodipicolinate reductase [Burkholderia sp. TJI49]
          Length = 265

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    GIK +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDSDAQLVGALDRAGSPFLGQDAGAFLG-KETGIKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  TL  +  + +H++  +IGTTGF+ ++  V+ + A    IV 
Sbjct: 60  LDAVFAQADYLIDFTRPEGTLAHVEAALRHDVKLVIGTTGFTAEQKAVLQAAAGKIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  +   GL+ M+DVLG+
Sbjct: 238 AQGALRAVHFLSAHGAGLFDMQDVLGL 264


>gi|21672429|ref|NP_660496.1| dihydrodipicolinate reductase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008348|sp|Q8K9Z5|DAPB_BUCAP RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|21623040|gb|AAM67707.1| dihydrodipicolinate reductase [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 273

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 162/271 (59%), Gaps = 4/271 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M +   RI++ G  GRMGQ LIKEI  N +  L + +V++  PLIGQ++G  +GI    +
Sbjct: 1   MKKKITRIAITGAMGRMGQVLIKEIQKNKNTVLTAALVKNNHPLIGQNIGEKIGIGKTSV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             S ++ +     D +IDF+ P+ T   L    +     IIGTTGFS KE + I+S+A+ 
Sbjct: 61  SISSDINIEKNDFDVLIDFTKPSGTFYFLEQCYEFKKNMIIGTTGFSEKEIKTINSYAKK 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             ++K+SN S+GIN L  L++   + L    D D  I+E HHR K+D PSGTAL +GE I
Sbjct: 121 IALIKASNFSIGINLLYQLIQKTTKILGNTSDID--IIEYHHRNKIDIPSGTALSIGENI 178

Query: 180 ANGRKVNLTDH-MVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           +      L  H +   + I +  R    IG +S+R+G+I+G+H+V+ +   E I ++HSA
Sbjct: 179 SKVMNWELNKHSLYYTKGITKKIRETKKIGFSSIRSGNIIGKHTVLFSSSDEEIKITHSA 238

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
           ++R  FA+G++ AA+W   +  GL++M D+L
Sbjct: 239 FNRESFAKGAIEAAVWIHEKKHGLFNMNDIL 269


>gi|16759058|ref|NP_454675.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29140608|ref|NP_803950.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161612387|ref|YP_001586353.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168262268|ref|ZP_02684241.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|198242536|ref|YP_002214018.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|213022053|ref|ZP_03336500.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213163012|ref|ZP_03348722.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213427505|ref|ZP_03360255.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213581663|ref|ZP_03363489.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213609676|ref|ZP_03369502.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213650149|ref|ZP_03380202.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|289810011|ref|ZP_06540640.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289826210|ref|ZP_06545322.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|20978452|sp|Q8Z9L9|DAPB_SALTI RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|189082803|sp|A9MYI6|DAPB_SALPB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226696359|sp|B5FHF8|DAPB_SALDC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|25284504|pir||AC0510 dihydrodipicolinate reductase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16501348|emb|CAD01219.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136232|gb|AAO67799.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161361751|gb|ABX65519.1| hypothetical protein SPAB_00076 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197937052|gb|ACH74385.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205348882|gb|EDZ35513.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|326621762|gb|EGE28107.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 273

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|149917188|ref|ZP_01905688.1| Dihydrodipicolinate reductase [Plesiocystis pacifica SIR-1]
 gi|149822104|gb|EDM81497.1| Dihydrodipicolinate reductase [Plesiocystis pacifica SIR-1]
          Length = 268

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 162/272 (59%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M+   + I V+G  GRMG ALI+E+ ++  +TL + + RSG P IGQD G  V    +G+
Sbjct: 1   MNTRMISILVVGARGRMGTALIREVMDSEDLTLGACVDRSGGPGIGQDAGRLVNRPELGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D L     SV  ++DFS P  T  ++N   +  +  +IGTTG S ++ +++      
Sbjct: 61  LVNDELRPRRGSV--VVDFSLPKATETNVNRCVEAGVPLVIGTTGLSGEQEQLLIDAGTK 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+  +  L   AA+ L P   W+ EI+E+HHR K D+PSGTAL + +A+
Sbjct: 119 IPVVYAANFSVGVTLMQRLAAVAAQALGP--HWEAEIVELHHRHKRDAPSGTALRIAQAV 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A  R+   +D  + +R  ++  R E  IG+  +R G   GEH+++  GEGE I L H A 
Sbjct: 177 AKSREQVFSDVAITDRSSRREVRQEEEIGVYGMRGGDSAGEHTLMFFGEGERIELIHRAG 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           DR IFARG+L AA WA +  PG+Y M DVLG+
Sbjct: 237 DRAIFARGALRAARWAANAEPGVYDMFDVLGL 268


>gi|197120412|ref|YP_002140839.1| dihydrodipicolinate reductase [Geobacter bemidjiensis Bem]
 gi|226696353|sp|B5EGX3|DAPB_GEOBB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|197089772|gb|ACH41043.1| dihydrodipicolinate reductase [Geobacter bemidjiensis Bem]
          Length = 267

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/271 (38%), Positives = 166/271 (61%), Gaps = 11/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMG  +I  +     + +   + R G P++GQD G   G+  +G+  SD+
Sbjct: 2   VKIAVCGAAGRMGGRIIAAVKEAEGVEICGALERPGHPMVGQDAGYNAGLGAIGVAISDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +Q+ D +IDF++P ++L++L + A +    +IG+TGF+ +E  + +  AR  P++ 
Sbjct: 62  LNAVVQACDVLIDFTAPKVSLKNLEVCALYGKSIVIGSTGFTPEERALAAELAREIPVII 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    ++   A+ L   +D+D EI+E HHR K DSPSGTA+ +GE +A+  G
Sbjct: 122 APNMSVGVNVCFKVLADVAKIL--GEDFDVEIVESHHRLKKDSPSGTAVRMGEVVASALG 179

Query: 183 RKVNLTDHMVLNRHIQQ-CA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT   IG+ ++R G IVGEH+V   G GE I ++H A+ 
Sbjct: 180 RDYN----KVANYHREGICGERTHDEIGMQTVRGGDIVGEHTVYFIGMGERIEITHRAHT 235

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RGS+ AA W  +  PG+Y M+DVLG+
Sbjct: 236 RDMFSRGSVRAAKWVVTAKPGVYDMQDVLGL 266


>gi|161525904|ref|YP_001580916.1| dihydrodipicolinate reductase [Burkholderia multivorans ATCC 17616]
 gi|189349377|ref|YP_001945005.1| dihydrodipicolinate reductase [Burkholderia multivorans ATCC 17616]
 gi|221202474|ref|ZP_03575505.1| dihydrodipicolinate reductase [Burkholderia multivorans CGD2M]
 gi|221208069|ref|ZP_03581074.1| dihydrodipicolinate reductase [Burkholderia multivorans CGD2]
 gi|238687067|sp|A9AHB2|DAPB_BURM1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|160343333|gb|ABX16419.1| Dihydrodipicolinate reductase [Burkholderia multivorans ATCC 17616]
 gi|189333399|dbj|BAG42469.1| dihydrodipicolinate reductase [Burkholderia multivorans ATCC 17616]
 gi|221171972|gb|EEE04414.1| dihydrodipicolinate reductase [Burkholderia multivorans CGD2]
 gi|221177647|gb|EEE10063.1| dihydrodipicolinate reductase [Burkholderia multivorans CGD2M]
          Length = 265

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 166/267 (62%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    G+K +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPSLGQDAGAFLG-KDTGVKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  +  + +H++  +IGTTGF+ ++  V+ + A    IV 
Sbjct: 60  IDAVFAQADYLIDFTRPEGTLAHVEAALRHDVKLVIGTTGFTAEQKAVLHAAAEKVAIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARDTGLFDMQDVLGL 264


>gi|220934150|ref|YP_002513049.1| Dihydrodipicolinate reductase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254767068|sp|B8GNX3|DAPB_THISH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|219995460|gb|ACL72062.1| Dihydrodipicolinate reductase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 267

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/263 (39%), Positives = 152/263 (57%), Gaps = 3/263 (1%)

Query: 8   ISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLA 66
           I ++G GGRMG+ LI+ I     + L     R+GS LIG D G   G+  +G+  S++ A
Sbjct: 4   ICIVGAGGRMGRTLIEAIQQAEGLDLTVATERAGSSLIGADAGELAGVGRLGVAISEDPA 63

Query: 67  MAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSS 126
             + + D +IDF+ P  TL  L I  +     +IGTTGF+  + + I   A+  P+V + 
Sbjct: 64  AQVAAFDVLIDFTRPEGTLAHLEICRKAGRAMVIGTTGFTEAQKQTIREAAKEIPVVFAP 123

Query: 127 NMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVN 186
           NMS+G+N    L++ AA  L    + D E++E HHR K+D+PSGTAL +GE +A     +
Sbjct: 124 NMSVGVNLCLKLLDLAARVL--GDEVDIEVIEAHHRHKVDAPSGTALRMGEVVAEALGRD 181

Query: 187 LTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFAR 246
           L    V  R      R   +IG  ++RAG IVGEH+V+ AG GE + ++H A  R  FA+
Sbjct: 182 LAQCAVYGREGHTGERERKTIGFETIRAGDIVGEHTVMFAGIGERVEITHKASSRMTFAK 241

Query: 247 GSLTAALWAKSQIPGLYSMRDVL 269
           G++ AA W K +  GLY M+DVL
Sbjct: 242 GAVRAAAWLKGRSAGLYDMQDVL 264


>gi|146310254|ref|YP_001175328.1| dihydrodipicolinate reductase [Enterobacter sp. 638]
 gi|167012020|sp|A4W6E7|DAPB_ENT38 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|145317130|gb|ABP59277.1| dihydrodipicolinate reductase [Enterobacter sp. 638]
          Length = 273

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQVRVAIAGAGGRMGRQLIQAALQMEGVVLGAALEREGSTLLGTDAGELAGAGHSGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL+ L    QH    IIGTTGF     + I   A++
Sbjct: 61  TVQSSLDAVKADFDVFIDFTRPEGTLEHLAFCRQHGKGMIIGTTGFDDAGKQAIKDAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V  R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAYALDKDLKDCAVYTREGHTGERVPGTIGFATVRAGDIVGEHTAIFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW KS+  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRSALWLKSKGNGLFDMRDVLNL 270


>gi|218708496|ref|YP_002416117.1| dihydrodipicolinate reductase [Vibrio splendidus LGP32]
 gi|254767070|sp|B7VJ13|DAPB_VIBSL RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|218321515|emb|CAV17467.1| Dihydrodipicolinate reductase [Vibrio splendidus LGP32]
          Length = 269

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K  H+N   ++ +   R  S L+G DVG   G     +   D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKAAHHNSEASVGAGSERPESSLVGVDVGELCGEGRFDVALVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+ A++  D I+DF++P  TL ++ +  +H    IIGTTGFS +E  VI + ++   IV 
Sbjct: 62  LSKAVEEFDVIVDFTAPVSTLANIELCKRHGKKLIIGTTGFSEEEKLVIDAASKEMAIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDVEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V +R      RT+  IG A++RAG I+GEH+ + A  GE + ++H A DR  F
Sbjct: 180 NELNDVAVWSREGITGERTKDEIGFATIRAGDIIGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M DVLG+
Sbjct: 240 ANGAIKAAVWLNDKPAGFYTMTDVLGL 266


>gi|204926868|ref|ZP_03218070.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204323533|gb|EDZ08728.1| dihydrodipicolinate reductase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 273

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKSGM 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   ++ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDDAGKQAIREASQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAGALDKDLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEIAHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G+L +ALW K++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGALRSALWLKTKKNGLFDMRDVLGL 270


>gi|146294031|ref|YP_001184455.1| dihydrodipicolinate reductase [Shewanella putrefaciens CN-32]
 gi|166224174|sp|A4Y9M3|DAPB_SHEPC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|145565721|gb|ABP76656.1| dihydrodipicolinate reductase [Shewanella putrefaciens CN-32]
 gi|319427370|gb|ADV55444.1| dihydrodipicolinate reductase [Shewanella putrefaciens 200]
          Length = 270

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 159/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G GGRMG+ LI+  ++   I L + I R+GS L+G D G   G+  + +   D+
Sbjct: 5   VRVAIVGAGGRMGRTLIEAAYHQEHILLGAAIERAGSSLVGVDAGELAGVGKLNVIIMDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A    D +IDF++P  ++  L+   +H    +IGTTGF+  +   I++FA   P+V 
Sbjct: 65  LDYATDDFDVLIDFTAPDASIVHLDWCVRHKKAMVIGTTGFNQAQKIQINAFAEQTPVVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWKLLELAAEVM---GDYTDIEIIEGHHRHKKDAPSGTALKMGEVIAKTL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLEKCAVYGREGITGERDRETIGFATIRAGDLVGEHTAMFADIGERLEITHKASSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 242 FANGAMRAARWVVEQKPGLYDMQQVLGL 269


>gi|37524604|ref|NP_927948.1| dihydrodipicolinate reductase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|39930946|sp|Q7N8W3|DAPB_PHOLL RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|36784028|emb|CAE12897.1| Dihydrodipicolinate reductase (DHPR) [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 273

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 109/274 (39%), Positives = 160/274 (58%), Gaps = 3/274 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R++++G GGRMG+ LI+ I+    + L + + RSGS LIG D G   GI   G+
Sbjct: 1   MADTDIRVAIVGAGGRMGRQLIQAIYQLDGVALGAALERSGSSLIGADAGELAGIGHNGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D+L   +   D +IDF+ P  TL  L I  Q+    +IGTTGF     + I   + +
Sbjct: 61  TVCDDLTSIVDDFDILIDFTRPEGTLTHLEICRQNGKAIVIGTTGFDEAGKQAIKQASAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA+ +   +  D EI+E HHR K+D+PSGTAL +GE+I
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM--GEYSDIEIIEAHHRHKVDAPSGTALAMGESI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 AHALGRDLKACAVYAREGYTGERDPKSIGFATIRAGDIVGEHTAMFADIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGL 273
            R  FA G++ AALW   +  GL+ M+DVL + L
Sbjct: 239 SRMTFANGAVKAALWLSGKNSGLFDMKDVLNLDL 272


>gi|308185620|ref|YP_003929751.1| Dihydrodipicolinate reductase [Pantoea vagans C9-1]
 gi|308056130|gb|ADO08302.1| Dihydrodipicolinate reductase [Pantoea vagans C9-1]
          Length = 271

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 156/271 (57%), Gaps = 3/271 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +RI+++G  GRMG+ LI+         L + + R GS L G D G   GI   GI  +
Sbjct: 2   STIRIAIVGAPGRMGRNLIQATQQAEGTELGAALARPGSSLTGSDAGELAGIGKNGILIA 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+L   I   D +IDF+ P  TL+ + I  +     +IGTTGF       I + A +  I
Sbjct: 62  DDLRAVINDFDVLIDFTRPEGTLEYMAICREQGKAMVIGTTGFDEAGKAAIRAAAEDIAI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N +  L+E AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAIA+ 
Sbjct: 122 VFAANFSVGVNLVLKLLEKAAKVM--GEYADIEIVEAHHRHKVDAPSGTALAMGEAIADA 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
            +  L DH V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A  R 
Sbjct: 180 MQWKLDDHAVYTREGHTGERQPQTIGFATVRAGDIVGEHTAMFADVGERVEITHKASSRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIGL 273
            FA G++ +ALW K +  GLY MRDVL + +
Sbjct: 240 TFANGAIKSALWLKDKKSGLYDMRDVLDLSM 270


>gi|120597831|ref|YP_962405.1| dihydrodipicolinate reductase [Shewanella sp. W3-18-1]
 gi|166224176|sp|A1RGQ6|DAPB_SHESW RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|120557924|gb|ABM23851.1| dihydrodipicolinate reductase [Shewanella sp. W3-18-1]
          Length = 270

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 159/268 (59%), Gaps = 5/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G GGRMG+ LI+  ++   I L + I R+GS L+G D G   G+  + +   D+
Sbjct: 5   VRVAIVGAGGRMGRTLIEAAYHQEHILLGAAIERAGSSLVGIDAGELAGVGKLNVIIMDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A    D +IDF++P  ++  L+   +H    +IGTTGF+  +   I++FA   P+V 
Sbjct: 65  LDYATDDFDVLIDFTAPDASIVHLDWCVRHKKAMVIGTTGFNQAQKIQINAFAEQTPVVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N +  L+E AAE +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMSVGVNLMWKLLELAAEVM---GDYTDIEIIEGHHRHKKDAPSGTALKMGEVIAKTL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG +VGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLEKCAVYGREGITGERDRETIGFATIRAGDLVGEHTAMFADIGERLEITHKASSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   Q PGLY M+ VLG+
Sbjct: 242 FANGAMRAARWVVEQKPGLYDMQQVLGL 269


>gi|237807798|ref|YP_002892238.1| dihydrodipicolinate reductase [Tolumonas auensis DSM 9187]
 gi|259586141|sp|C4LCT8|DAPB_TOLAT RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|237500059|gb|ACQ92652.1| dihydrodipicolinate reductase [Tolumonas auensis DSM 9187]
          Length = 270

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 111/280 (39%), Positives = 166/280 (59%), Gaps = 25/280 (8%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P+RI+++G  GRMG+AL++ I  N  +TL + + R GS +IG DVG+  G+  M +  +
Sbjct: 3   APIRIALMGCQGRMGKALLEAIRANEQVTLGTALERPGSTVIGLDVGDLNGLGAMNVLIA 62

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+L       D IIDF+ P +TL++L  +  +N   +IGTTGF       I+  A+   I
Sbjct: 63  DDLEKVKDQFDVIIDFTRPEVTLKNLAFAVANNKRIVIGTTGFDDAGKAAINEAAKKIGI 122

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           V +SN S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE +A 
Sbjct: 123 VFASNFSVGVNLVFKLLEQAAKVM---GDYTDIEIIEGHHRHKVDAPSGTALSMGEVVAK 179

Query: 182 GRKVNLTDHMVLNRHIQQCA----------RTEGSIGIASLRAGSIVGEHSVVIAGEGES 231
                      L R ++QCA          R   +IG A++RAG +VGEH+V+ A  GE 
Sbjct: 180 ----------TLGRDLKQCAVYGREGITGERDRNTIGFATIRAGDLVGEHTVMFADIGER 229

Query: 232 ITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           + ++H A  R  FA G++ AA W K Q  GL+ M+DVL +
Sbjct: 230 VEITHKASSRLTFANGAVRAANWLKDQPCGLFDMQDVLNL 269


>gi|261823077|ref|YP_003261183.1| dihydrodipicolinate reductase [Pectobacterium wasabiae WPP163]
 gi|261607090|gb|ACX89576.1| dihydrodipicolinate reductase [Pectobacterium wasabiae WPP163]
          Length = 273

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 158/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ +     + L + + RSGS LIG D G   G+   GI
Sbjct: 1   MKDSSIRIAVVGAGGRMGRQLIQAVEQMDGVVLGAALERSGSSLIGSDAGELAGLGKNGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +++L       D +IDF+ P  TL  L    QH    IIGTTGF       I   A++
Sbjct: 61  TVNESLDAVQNDFDILIDFTQPEGTLAHLAFCRQHRKGMIIGTTGFDDAGKAAIKQAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADALGRDLKSCAVYAREGHTGERDPKSIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA+W  S+  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRAAIWINSKEDGLFDMRDVLSL 270


>gi|107103856|ref|ZP_01367774.1| hypothetical protein PaerPA_01004927 [Pseudomonas aeruginosa PACS2]
          Length = 256

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 155/257 (60%), Gaps = 3/257 (1%)

Query: 16  MGQALIKEIHNNPSIT-LHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDG 74
           MG+ LI+ +        L + + R  S L+G D G   G+  +G+  S +L    +  D 
Sbjct: 1   MGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGDLGKVCEEFDV 60

Query: 75  IIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINF 134
           +IDF+ P++TL++L    +     +IGTTGFS  E  +++  A++ PIV ++N S+G+N 
Sbjct: 61  LIDFTHPSVTLKNLEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVFAANFSVGVNL 120

Query: 135 LGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLN 194
              L++TAA  L    + D EI+E HHR K+D+PSGTAL +GE +A     +L +  V  
Sbjct: 121 CLKLLDTAARVL--GDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALGRDLQEVAVYG 178

Query: 195 RHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALW 254
           R  Q  AR   +IG A++RAG +VG+H+V+ A EGE + ++H A  R  FARG++ AALW
Sbjct: 179 REGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTFARGAVRAALW 238

Query: 255 AKSQIPGLYSMRDVLGI 271
            + +  GLY M+DVLG+
Sbjct: 239 LEGKENGLYDMQDVLGL 255


>gi|156935441|ref|YP_001439357.1| dihydrodipicolinate reductase [Cronobacter sakazakii ATCC BAA-894]
 gi|166222635|sp|A7MI96|DAPB_ENTS8 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|156533695|gb|ABU78521.1| hypothetical protein ESA_03300 [Cronobacter sakazakii ATCC BAA-894]
          Length = 273

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 152/273 (55%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M ++ +R+++ G  GRMG+ LI+       + L + +VR GS L+G D G   G    G+
Sbjct: 1   MQEAQVRVAIAGANGRMGRQLIQAALAMDGVALGAALVREGSTLLGADAGELAGTGATGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               NL       D +IDF+ P  TL  L     HN   +IGTTGF       I   A  
Sbjct: 61  TLKSNLEAVKDDFDVLIDFTRPEGTLAYLAFCRAHNKGMVIGTTGFDDAGKAAIHETATA 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            P+V ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IPVVFAANFSVGVNVMLKLLEKAAQVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L    V  R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALNKDLKSCAVYAREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AALW K+Q  G + MRDVL +
Sbjct: 238 SSRMTFANGAVRAALWLKAQKKGFFDMRDVLNL 270


>gi|254253258|ref|ZP_04946576.1| Dihydrodipicolinate reductase [Burkholderia dolosa AUO158]
 gi|124895867|gb|EAY69747.1| Dihydrodipicolinate reductase [Burkholderia dolosa AUO158]
          Length = 265

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    GIK +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDSDAQLVGALDRAGSPFLGQDAGAFLG-KETGIKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  TL  +  + +H++  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQADYLIDFTRPEGTLAHVEAALRHDVKLVIGTTGFTAEQKAALHAAAGKIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|85859279|ref|YP_461481.1| dihydrodipicolinate reductase [Syntrophus aciditrophicus SB]
 gi|123516499|sp|Q2LTA0|DAPB_SYNAS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|85722370|gb|ABC77313.1| dihydrodipicolinate reductase [Syntrophus aciditrophicus SB]
          Length = 268

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 151/260 (58%), Gaps = 2/260 (0%)

Query: 12  GGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQS 71
           GGG+MG  +I  +     + L  ++ +   P  G+D+G F+G    GI    +L   I  
Sbjct: 9   GGGKMGARIISLLEEEGGMQLTGVVEKKDHPAAGKDIGEFLGSGKRGIVIQSDLGFCIAG 68

Query: 72  VDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLG 131
            D IIDF+S   +++ + ++A+H    +IG+TGFS  E + I  FA+N P V + NMS+G
Sbjct: 69  GDVIIDFTSHEASMRHMEMAAEHKRPIVIGSTGFSADEMDRIRKFAQNVPCVLAPNMSVG 128

Query: 132 INFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHM 191
           +N +  L++  AE L    D+D EILE+HHR K D+PSGTAL + + +A      L +  
Sbjct: 129 VNVMFKLLKIVAETL--GDDYDVEILEVHHRLKKDAPSGTALKMAQVVAEALGRELDEVG 186

Query: 192 VLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTA 251
           +  R      R++  IGI +LRAG IVGEH+V+    GE + L H A+ R  FARG++ A
Sbjct: 187 IYERKGLIGERSKKEIGIQALRAGDIVGEHTVIFGAVGERLELIHRAHSRDNFARGAIRA 246

Query: 252 ALWAKSQIPGLYSMRDVLGI 271
           A W   Q PGLY M+DVLG 
Sbjct: 247 AKWVVRQEPGLYDMQDVLGF 266


>gi|114777591|ref|ZP_01452572.1| dihydrodipicolinate reductase [Mariprofundus ferrooxydans PV-1]
 gi|114552062|gb|EAU54579.1| dihydrodipicolinate reductase [Mariprofundus ferrooxydans PV-1]
          Length = 269

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 162/269 (60%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +R+ V+G  GRMG+ L++ +  +    L     RSGS  +G+D G   G+  + ++  
Sbjct: 2   SGVRVVVVGASGRMGRMLVRAVAESSRCDLVGATERSGSEFLGRDAGEMAGVETLAVRII 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++     + D +IDF++PA TL+     A+  +  +IGTTGF   + + +     ++P+
Sbjct: 62  DDIQQC-PAADVLIDFTAPAATLKHAAFVAERGMGMVIGTTGFDAGQMQQLRDILADSPV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    L+E AA+ L    D+D EI E HH+ K+D+PSGTAL +G+A+A+G
Sbjct: 121 VMAANYSVGVNLALSLIERAAQVL--GDDYDAEIFEAHHKHKVDAPSGTALAMGKALASG 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R V L D  VL+R      R  GSIG + +R G+IVGEH  +   + E I ++H A DR 
Sbjct: 179 RGVELDDVAVLSREGITGVRKPGSIGFSVVRGGNIVGEHQAMFIADEERIEINHMASDRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FARG++ AA W  +Q  G Y M+D+LG+
Sbjct: 239 VFARGAVRAAGWLSAQSVGWYDMQDMLGL 267


>gi|227114252|ref|ZP_03827908.1| dihydrodipicolinate reductase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 273

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 114/273 (41%), Positives = 158/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + RSGS LIG D G   G+   GI
Sbjct: 1   MKDSSIRIAVVGAGGRMGRQLIQAIEQMDGVVLGAALERSGSSLIGSDAGELAGLGKSGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +++L       D +IDF+ P  TL  L    QH    IIGTTGF       I   A++
Sbjct: 61  TVNESLDAVQNDFDILIDFTRPEGTLAHLAFCRQHRKGMIIGTTGFDDAGKAAIKQAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADALGRDLKSCAVYAREGYTGERDPKSIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA+W  S+  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRAAIWISSKENGLFDMRDVLSL 270


>gi|118594562|ref|ZP_01551909.1| dihydrodipicolinate reductase [Methylophilales bacterium HTCC2181]
 gi|118440340|gb|EAV46967.1| dihydrodipicolinate reductase [Methylophilales bacterium HTCC2181]
          Length = 270

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 156/258 (60%), Gaps = 3/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           G+MGQALI+EI ++    L   +    S  IGQD G+F G+    I   D    + ++ D
Sbjct: 14  GKMGQALIQEIISDKITKLCGAMEHKDSSFIGQDAGHFFGVKT-NINIKDCFDDSSKAAD 72

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+ P+ +L+ L     H I +++GTTGFS  E E+I   + +  I  + NMS+G+N
Sbjct: 73  VLIDFTRPSASLEYLAYCRNHKIKYVLGTTGFSEGEKEIIEDASNDISICFAPNMSVGVN 132

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L E A + L   +D+D EI+E HH+ K+D+PSGTAL LG+A+A+     L++H V 
Sbjct: 133 LLLSLTEMATKVL--HEDFDIEIIETHHKDKVDAPSGTALGLGQAVASSSNRTLSEHGVF 190

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R    IG +++R G +VG+H+V+ AG+GE I L+H A  R+ FA+G+L AA 
Sbjct: 191 QREGIMPPRQRTDIGFSTIRGGDVVGDHTVLYAGDGERIELTHKASSRKTFAKGALRAAK 250

Query: 254 WAKSQIPGLYSMRDVLGI 271
           +  ++  GL+ MRDVL +
Sbjct: 251 FIATKTQGLFDMRDVLDL 268


>gi|255019871|ref|ZP_05291946.1| Dihydrodipicolinate reductase [Acidithiobacillus caldus ATCC 51756]
 gi|254970651|gb|EET28138.1| Dihydrodipicolinate reductase [Acidithiobacillus caldus ATCC 51756]
          Length = 289

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 162/270 (60%), Gaps = 5/270 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P R++V    GRMG+AL+  +  +  + L + I R G+  +G+D G   G+  +G+   
Sbjct: 16  APTRVAVDAVAGRMGRALVAALVEHADLRLGAAIGRPGADYLGEDAGRLAGVGDLGVVVC 75

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D L   +   D +I+F+   + L+ L+ +A      ++G+TGF  ++   I + AR+ P+
Sbjct: 76  DRLDAVLDDFDVLIEFAPADIALKHLHAAAASGRAVVLGSTGFGAEQQAEIDALARSIPL 135

Query: 123 VKSSNMSLGINFL-GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           V++ NMS+G+N L  FL +  A      +D+D EILE HH +K D+PSGTAL LG A+A 
Sbjct: 136 VQAPNMSVGVNVLTAFLPQIVAAL---GEDYDVEILEAHHGQKRDAPSGTALQLGRAVAA 192

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR V+L      +R+     R  GSIG ASLRA  +VGEHSV +AG GE + L+H A  R
Sbjct: 193 GRGVDLDAVACWDRNGAPGPRQPGSIGFASLRAADVVGEHSVWLAGAGERLELTHRAGSR 252

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R FA G+L AA W + + PG Y M+DVLG+
Sbjct: 253 RNFAEGALRAASWVRQRSPGHYDMQDVLGL 282


>gi|227329313|ref|ZP_03833337.1| dihydrodipicolinate reductase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 273

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 158/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + RSGS LIG D G   G+   GI
Sbjct: 1   MKDSSIRIAVVGAGGRMGRQLIQAIEQMDGVVLGAALERSGSSLIGSDAGELAGLGKSGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +++L       D +IDF+ P  TL  L    QH    IIGTTGF       I   A++
Sbjct: 61  TVNESLDAVQNDFDILIDFTRPEGTLAHLAFCRQHRKGMIIGTTGFDDAGKAAIKQAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADALGRDLKSCAVYAREGYTGERDPKSIGFATVRAGDIVGEHTAMFADVGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA+W  ++  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRAAIWISAKESGLFDMRDVLSL 270


>gi|229557968|ref|YP_128820.2| dihydrodipicolinate reductase [Photobacterium profundum SS9]
 gi|90101249|sp|Q6LUK7|DAPB_PHOPR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
          Length = 269

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 157/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K   N+    L     RS S LIG D G   GI  + I   D+
Sbjct: 2   VRIAIAGAAGRMGRQLLKATVNSEKAALGVATERSESTLIGVDAGELAGIGNVSIAIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA A    D +IDF++P +TL ++ +  Q+    +IGTTGFS +E  +I   A++  IV 
Sbjct: 62  LAKAANDFDVLIDFTAPVVTLANIELCKQYGKKIVIGTTGFSEEERVLIDLAAKDIAIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GGYTDIEIIEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLSDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W      G Y+M+DVLG+
Sbjct: 240 ANGAVRAAVWLADNQSGFYTMQDVLGL 266


>gi|90412470|ref|ZP_01220473.1| dihydrodipicolinate reductase [Photobacterium profundum 3TCK]
 gi|90326507|gb|EAS42913.1| dihydrodipicolinate reductase [Photobacterium profundum 3TCK]
          Length = 269

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 157/268 (58%), Gaps = 5/268 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K   N+    L     RS S LIG D G   GI  + I   D+
Sbjct: 2   VRIAIAGAAGRMGRQLLKATANSEKAALGVATERSESTLIGVDAGELAGIGNISIAIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D +IDF++P  TL ++ +  Q+    +IGTTGFS +E  +I   A++  IV 
Sbjct: 62  LAKVANDFDVLIDFTAPVATLANIELCKQYGKKIVIGTTGFSEEERALIDLAAKDIAIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTA+ +GEAIA   
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTAIGMGEAIAGAM 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
              L+D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  
Sbjct: 179 GNKLSDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA+W      G Y+M+DVLG+
Sbjct: 239 FANGAVRAAVWLADNQSGFYTMQDVLGL 266


>gi|222054230|ref|YP_002536592.1| Dihydrodipicolinate reductase [Geobacter sp. FRC-32]
 gi|254767049|sp|B9M381|DAPB_GEOSF RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|221563519|gb|ACM19491.1| Dihydrodipicolinate reductase [Geobacter sp. FRC-32]
          Length = 267

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 162/271 (59%), Gaps = 11/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++++V G  GRMGQ +I  I       L   + R G PL+GQD G   G   + +K SD+
Sbjct: 2   VKVAVCGAAGRMGQRIIVAITEAEGAELSGALERPGHPLVGQDAGILAGCGELKVKISDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   ++  D +IDF++P ++L++L   A      +IG+TGF+ +E  + +  AR+ P V 
Sbjct: 62  INAVVEGCDVLIDFTTPKVSLKNLEACALKKKSIVIGSTGFTPEERVLAAELARDIPAVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    +++  A+ L    D+D EI+E+HH +K D+PSGTA+ +GE +A   G
Sbjct: 122 APNMSVGVNVCFKVLKDVAKTL--GDDFDVEIVELHHNKKKDAPSGTAVRMGEVVAEALG 179

Query: 183 RKVNLTDHMVLNRHIQQ-CA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT+  IG+ ++R G I+GEH+V   G GE I +SH A  
Sbjct: 180 RDYN----KVANYHREGICGERTKEEIGMQTVRGGDIIGEHTVYFIGMGERIEISHRAMT 235

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RGS+ AA W   + PGLY M+DVLG+
Sbjct: 236 RDMFSRGSVRAAKWVVGKKPGLYDMQDVLGL 266


>gi|46912223|emb|CAG19018.1| putative dihydrodipicolinate reductase [Photobacterium profundum
           SS9]
          Length = 295

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 157/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K   N+    L     RS S LIG D G   GI  + I   D+
Sbjct: 28  VRIAIAGAAGRMGRQLLKATVNSEKAALGVATERSESTLIGVDAGELAGIGNVSIAIVDD 87

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA A    D +IDF++P +TL ++ +  Q+    +IGTTGFS +E  +I   A++  IV 
Sbjct: 88  LAKAANDFDVLIDFTAPVVTLANIELCKQYGKKIVIGTTGFSEEERVLIDLAAKDIAIVM 147

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 148 APNYSVGVNLVFKLLEKAAKVM--GGYTDIEIIEAHHRHKVDAPSGTAIGMGEAIAGAMG 205

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 206 NKLSDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 265

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W      G Y+M+DVLG+
Sbjct: 266 ANGAVRAAVWLADNQSGFYTMQDVLGL 292


>gi|254295465|ref|YP_003061488.1| dihydrodipicolinate reductase [Hirschia baltica ATCC 49814]
 gi|254043996|gb|ACT60791.1| dihydrodipicolinate reductase [Hirschia baltica ATCC 49814]
          Length = 268

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 153/268 (57%), Gaps = 4/268 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I++ G  GRMGQ+L++         +     R GS  + QD+G   G+ P  IK S +
Sbjct: 3   LKIAIAGVAGRMGQSLVRACSTLTDCEIVGGTERPGSGALDQDIGVLAGLPPSDIKVSLS 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNI-VHIIGTTGFSVKENEVISSFARNAPIV 123
            A A +  D  IDF++P  TL S+       +   IIGTTGF+  E+E +  F++   IV
Sbjct: 63  PAEAARHADIWIDFTAPVPTLASMTALDTTGVKAVIIGTTGFNEAEDEALQEFSKRFSIV 122

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           K+ N SLG+  L  LVE AA  L    DWD E+LE HHRRK+D+PSGTAL+LGEA A GR
Sbjct: 123 KAGNFSLGVAMLSALVEQAAARL--GDDWDIEVLETHHRRKVDAPSGTALMLGEAAAKGR 180

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
              L D            R  G IG +  RAG ++G+H V+   + E I+L H+A DR +
Sbjct: 181 NAPLDDLKTPPYDGITGEREAGKIGFSVRRAGGVIGDHEVMFGSDEELISLRHTALDRNV 240

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA+G++ A  WA  Q  G Y++RDVL +
Sbjct: 241 FAKGAIRAGQWAIQQPVGFYTIRDVLDL 268


>gi|238758983|ref|ZP_04620154.1| Dihydrodipicolinate reductase [Yersinia aldovae ATCC 35236]
 gi|238702794|gb|EEP95340.1| Dihydrodipicolinate reductase [Yersinia aldovae ATCC 35236]
          Length = 273

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 160/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ +  +  + L + I R GS L+G D G   GI  + +
Sbjct: 1   MTDSTIRIAVVGAGGRMGRQLIQAVAQSEGVVLGAAIERVGSTLVGSDAGELAGIGMLNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+++      D +IDF+ P  TL+ L I  +     +IGTTGF       I     +
Sbjct: 61  TVSDDVSKVTDHFDVLIDFTRPEGTLEHLAICRKWRKAMVIGTTGFDEAGKAAIQEATAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADSLGWSLKDCAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW   +  GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSALWVSERDNGLFDMRDVLNL 270


>gi|293392914|ref|ZP_06637231.1| dihydrodipicolinate reductase [Serratia odorifera DSM 4582]
 gi|291424448|gb|EFE97660.1| dihydrodipicolinate reductase [Serratia odorifera DSM 4582]
          Length = 273

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI++ G GGRMG+ LI+ +     + L + + R GS L+G D G   GI  +G+
Sbjct: 1   MTDSQIRIAIAGSGGRMGRQLIQAVQQAQGVVLGAALERPGSSLLGTDAGELAGIGALGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             S++L       D +IDF+ P  TL  L    +H    +IGTTGF       I   A+ 
Sbjct: 61  TVSESLQKVADDFDILIDFTRPEGTLAHLAFCVEHRKAMVIGTTGFDDAGKAAIRDAAQQ 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIVEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADALGRDLKDCAVYAREGHTGERDPHSIGFATIRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA W   +  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGAVRAASWLSDRQNGLFDMRDVLGL 270


>gi|149192444|ref|ZP_01870639.1| dihydrodipicolinate reductase [Vibrio shilonii AK1]
 gi|148833725|gb|EDL50767.1| dihydrodipicolinate reductase [Vibrio shilonii AK1]
          Length = 269

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 155/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ L+K   +N    + +   R  S L+G DVG   G     +   D+
Sbjct: 2   VRIAIAGAAGRMGRNLVKATFHNNQAEVGAGSERPESSLVGVDVGELCGEGRFDVALVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  +I   D IIDF++P  TL +L +  QH    +IGTTGFS +E  +I   A++ P+V 
Sbjct: 62  LNKSIDDFDVIIDFTAPKSTLANLELCKQHGKKMVIGTTGFSEEEKAIIDEAAQSVPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      RT   IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NELNDVAVYAREGITGERTRDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   +  G Y+M +VLG+
Sbjct: 240 ANGAVKAAVWLNDKPAGFYTMTEVLGL 266


>gi|253690010|ref|YP_003019200.1| dihydrodipicolinate reductase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259586135|sp|C6DF00|DAPB_PECCP RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|251756588|gb|ACT14664.1| dihydrodipicolinate reductase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 273

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 114/273 (41%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + RSGS LIG D G   G+   GI
Sbjct: 1   MKNSSIRIAVVGAGGRMGRQLIQAIEQMDGVVLGAALERSGSSLIGSDAGELAGLGKSGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              ++L       D +IDF+ P  TL  L    QH    IIGTTGF       I   A++
Sbjct: 61  TVKESLNAVQNDFDILIDFTRPEGTLAHLAFCHQHRKGMIIGTTGFDDAGKAAIKQAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADALGRDLKSCAVYAREGHTGERDPKSIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA+W  S+  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRAAIWISSKENGLFDMRDVLSL 270


>gi|29603422|emb|CAD88191.1| dihydrodipicolinate reductase [Pseudomonas fluorescens SBW25]
          Length = 267

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/265 (38%), Positives = 163/265 (61%), Gaps = 5/265 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHN-NPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+ L++ +   +P+  L + IVR GS LIG D G    +  +G+  S N
Sbjct: 3   RIAVMGAAGRMGKTLVEAVQQRSPASGLTAAIVRPGSTLIGADAGELASLGRIGVSLSGN 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P + L++L    ++    +IGTTG ++++ ++++   ++ PIV 
Sbjct: 63  LEQVADEFDVLIDFTLPDVMLKNLAFC-RNGKAMVIGTTGLTLEQKQLLAEAGKDIPIVF 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++ AA   +   + D EI+E HHR K+D+PSGTAL +GEAIA+   
Sbjct: 122 AANFSVGVNLSLKLLDLAAR--VRGDEADIEIIETHHRHKIDAPSGTALRMGEAIADALG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L+   V  R     AR   +IG A++R G +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 180 RDLSKVAVYGREGHTGARARDTIGFATVRGGDVVGDHTVLFASEGERLEITHKASSRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AALW + +  GLY MRDVL
Sbjct: 240 AKGAVRAALWLEGRAAGLYDMRDVL 264


>gi|89067210|ref|ZP_01154723.1| dihydrodipicolinate reductase [Oceanicola granulosus HTCC2516]
 gi|89046779|gb|EAR52833.1| dihydrodipicolinate reductase [Oceanicola granulosus HTCC2516]
          Length = 270

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 160/258 (62%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+ L++ +  + +  L   +VR G    G+DVG   G + MG+  + +   A     
Sbjct: 15  GRMGRMLVETVAASDACRLVGALVRPGHEWEGRDVGEATGGAAMGVPVTSDALEAFAKAQ 74

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF++PA T++   ++AQ    H+IGTTGF   +   I++ AR+A +V++ NMSLG+N
Sbjct: 75  AVIDFTTPAATVEFAALAAQARATHVIGTTGFGDDDLACIAAAARHAVVVRAGNMSLGVN 134

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  L    A  L   +++D EI+E HHR K+D+PSGTAL+LGEA A GR V L++    
Sbjct: 135 LLVGLTRKVAAAL--GEEFDIEIVEAHHRHKVDAPSGTALMLGEAAAEGRGVALSEAAER 192

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R  Q   R  G+IG +++R G IVGEH V+ AG GE + L H A DR IFARG++ AAL
Sbjct: 193 GRDGQTGPRGAGAIGFSAVRGGDIVGEHDVLFAGAGERVMLRHVATDRGIFARGAVRAAL 252

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W + + PG Y+M DVLG+
Sbjct: 253 WGQDKRPGEYTMADVLGL 270


>gi|70734324|ref|YP_257964.1| dihydrodipicolinate reductase [Pseudomonas fluorescens Pf-5]
 gi|90101252|sp|Q4KIG9|DAPB_PSEF5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|68348623|gb|AAY96229.1| dihydrodipicolinate reductase [Pseudomonas fluorescens Pf-5]
          Length = 268

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/265 (38%), Positives = 157/265 (59%), Gaps = 4/265 (1%)

Query: 7   RISVLGG-GRMGQALIKEIH-NNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V+G  GRMG+ L++ +   +P   L + IVR GS L+G D G    +  +G+  SD+
Sbjct: 3   RIAVMGAAGRMGKTLVEAVQLRSPLSGLTAAIVRPGSSLVGADAGELASLGRLGVPMSDS 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+ P + L++L    +     +IGTTG   +E ++++   +  PIV 
Sbjct: 63  LEKVVDEFDVLIDFTLPEVMLKNLAFCRKAGKAMVIGTTGLGAREKQLLAEAGKEIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE IA+   
Sbjct: 123 AANFSVGVNLSLKLLDMAARVL--GDDADIEIIEAHHRHKIDAPSGTALRMGEVIASALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R     AR   +IG A++R G +VG+H+V+ A EGE + ++H A  R  F
Sbjct: 181 RDLQQVAVYGREGHTGARERETIGFATVRGGDVVGDHTVLFATEGERLEITHKASSRMTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+G++ AALW   +  GLY M+DVL
Sbjct: 241 AKGAVRAALWLDGREAGLYDMQDVL 265


>gi|188532863|ref|YP_001906660.1| Dihydrodipicolinate reductase [Erwinia tasmaniensis Et1/99]
 gi|238690914|sp|B2VH06|DAPB_ERWT9 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|188027905|emb|CAO95762.1| Dihydrodipicolinate reductase [Erwinia tasmaniensis Et1/99]
          Length = 273

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 158/272 (58%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +RI+++G  GRMG+ LI+ +       L + +VRSGS L+G D G   G   +GI
Sbjct: 1   MSNAEIRIAIVGAAGRMGRQLIQAVVLAEGARLGAALVRSGSSLVGTDAGELAGCGALGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D+L       D +IDF+ P  TL  L    QH+   +IGTTGF       I + A++
Sbjct: 61  TLTDDLEAVANDFDVLIDFTRPEGTLHYLAFCRQHHKAMVIGTTGFDDAGKAAIEAAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  LVE AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNVVLKLVEKAAKVM--GEYADIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    +L  H V  R      R   +IG A++RAG IVGEH+ + A  GE + +SH A 
Sbjct: 179 ADAMSWDLKQHAVYAREGFTGEREAQTIGFATVRAGDIVGEHTAMFADIGERVEISHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA+G++ AA+W   +  GLY MR VL +
Sbjct: 239 SRMTFAKGAVRAAIWLDGRKKGLYDMRCVLNL 270


>gi|221069916|ref|ZP_03546021.1| Dihydrodipicolinate reductase [Comamonas testosteroni KF-1]
 gi|220714939|gb|EED70307.1| Dihydrodipicolinate reductase [Comamonas testosteroni KF-1]
          Length = 277

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 155/267 (58%), Gaps = 3/267 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P R++V G  GRMG  LI+ I N+    L + + R+ SP IG D   F+G  P G+K  
Sbjct: 10  TPQRVAVAGASGRMGHMLIEAILNSSDCVLAAALDRADSPAIGTDPSAFLG-RPSGLKIE 68

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            ++  A+   D +IDF+ P  TL+ L ++A   +  +IGTTGFS ++   I+ FA+   I
Sbjct: 69  SDVREALSKADCLIDFTRPEGTLEHLAVAADLGVGVVIGTTGFSEEQKAQIAEFAQKTSI 128

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L+E AA+ L     +D EI+E HH+ K+D+PSGTAL +GE IA  
Sbjct: 129 VFAPNMSVGVNVTFKLLEMAAKALQQGG-YDIEIVEAHHKHKVDAPSGTALKMGEVIAEA 187

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           +   L D  V  R      R   SIG A++R G IVG+H+V+ AG GE I +SH +  R 
Sbjct: 188 QGTKLADRAVYERFGHTGERKADSIGFATVRGGDIVGDHTVLFAGTGERIEISHKSSSRA 247

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVL 269
            +A GSL A  +   +  G Y M DVL
Sbjct: 248 GYANGSLRAVAYLADKKTGQYDMYDVL 274


>gi|238918630|ref|YP_002932144.1| dihydrodipicolinate reductase, [Edwardsiella ictaluri 93-146]
 gi|259586131|sp|C5B7N2|DAPB_EDWI9 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238868198|gb|ACR67909.1| dihydrodipicolinate reductase, putative [Edwardsiella ictaluri
           93-146]
          Length = 272

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 151/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G GGRMG+ LI      P +TL + + R GS L+G D G   G    G+    +
Sbjct: 5   IRVAIAGAGGRMGRQLIAAAAAIPGVTLGAALEREGSGLLGCDAGELAGCGVTGVTVESS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  T+  L     H    +IGTTGFS +E   I + +++  IV 
Sbjct: 65  LERVAGQFDILIDFTRPEGTMAHLAFCQAHGKAMVIGTTGFSEQEKATIEAASQHVAIVL 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N +  L+E AA+ +      D EILE HHR K+D+PSGTAL +GEAIA    
Sbjct: 125 AANFSVGVNVMLRLLEKAAQVM--GSYCDIEILEAHHRHKVDAPSGTALAMGEAIAGALG 182

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R  GSIG A+LRAG IVGEH+ + A  GE + ++H A  R  F
Sbjct: 183 RSLESCAVYTRLGHTGERAPGSIGFATLRAGDIVGEHTAMFADVGERLEITHKASSRMTF 242

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W  +Q PG+Y M DVL +
Sbjct: 243 ASGAMRAAQWLGAQQPGMYDMCDVLAL 269


>gi|221236600|ref|YP_002519037.1| dihydrodipicolinate reductase [Caulobacter crescentus NA1000]
 gi|220965773|gb|ACL97129.1| dihydrodipicolinate reductase [Caulobacter crescentus NA1000]
          Length = 268

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 159/269 (59%), Gaps = 19/269 (7%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P++I++ G  GRMG+A+ + +       + +   R G      D G        G+   +
Sbjct: 15  PVKIAIAGANGRMGRAVAQALEGRSDAVVAARFERPG------DAGE-------GLVARE 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQ-SLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
               A+ + + +IDF+ P  ++  +   +A      +IG+TGFS ++ + I + A    I
Sbjct: 62  T---ALAAAEAVIDFTLPEASVALAEEAAANGGPALVIGSTGFSDEQLDRIDAAATKIVI 118

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S N SLG+N L  LV  AA  L PA+DWD E+ E HH+RK+D+PSGTAL+LGEA A G
Sbjct: 119 VRSGNYSLGVNMLMGLVRQAAAAL-PAQDWDIEVFEAHHKRKIDAPSGTALMLGEAAAEG 177

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R +NL       R      R +G IG + +R G I+GEHSV+ AGE ES+TLSHSA DR 
Sbjct: 178 RGINLAKVSDRGRDGVTGPRKDGDIGFSVVRGGGIIGEHSVIFAGESESLTLSHSAIDRG 237

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FARG++ AA+W K + PGLY M+DVLG 
Sbjct: 238 LFARGAIAAAVWVKGKPPGLYDMQDVLGF 266


>gi|118581465|ref|YP_902715.1| dihydrodipicolinate reductase [Pelobacter propionicus DSM 2379]
 gi|166222662|sp|A1ATI7|DAPB_PELPD RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|118504175|gb|ABL00658.1| dihydrodipicolinate reductase [Pelobacter propionicus DSM 2379]
          Length = 267

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 155/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMGQ LI  +     + L  ++ R   PL+GQD G   G   +G+  SD+
Sbjct: 2   IKIAVCGAAGRMGQRLINSVQEAEGVCLSGVLERPAHPLVGQDAGLVAGCGALGVSISDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   I   D +IDF++P ++L++L          +IG+TGF+ +E ++     RN   + 
Sbjct: 62  LNAVIAGCDVLIDFTAPKVSLKNLEACGLQRKSIVIGSTGFTPEERQLAMELTRNISAIL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    +++  A  L    D+D EI+E HHR K+D+PSGTA+ +G+ +A    
Sbjct: 122 APNMSVGVNVCFKILKDIAATL--GDDFDVEIVESHHRMKVDAPSGTAVRMGQVVAEALG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +       +R     +RT+  IG+ ++R G IVGEH+V   G GE I LSH A +R +F
Sbjct: 180 RDYDRVANFHREGITGSRTKDEIGMQTIRGGDIVGEHTVYFIGMGERIELSHRAMNRDMF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +RG++ AA W   Q PGLY M+DVLG+
Sbjct: 240 SRGAVRAATWVVGQAPGLYDMQDVLGL 266


>gi|206577571|ref|YP_002240501.1| dihydrodipicolinate reductase [Klebsiella pneumoniae 342]
 gi|288937200|ref|YP_003441259.1| dihydrodipicolinate reductase [Klebsiella variicola At-22]
 gi|290512621|ref|ZP_06551987.1| dihydrodipicolinate reductase [Klebsiella sp. 1_1_55]
 gi|226696356|sp|B5Y210|DAPB_KLEP3 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|206566629|gb|ACI08405.1| dihydrodipicolinate reductase [Klebsiella pneumoniae 342]
 gi|288891909|gb|ADC60227.1| dihydrodipicolinate reductase [Klebsiella variicola At-22]
 gi|289774962|gb|EFD82964.1| dihydrodipicolinate reductase [Klebsiella sp. 1_1_55]
          Length = 273

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 154/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALQMEGVALGAALEREGSSLVGSDAGELAGAGKAGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D +IDF+ P  TL  L    +H    +IGTTGF     + I   A+ 
Sbjct: 61  AVQSSLTAVKDDFDVLIDFTRPEGTLNHLAFCREHGKGMVIGTTGFDDAGKQAIRDAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L +  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALNKDLKECAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLKDKKNGLFDMRDVL 268


>gi|331005321|ref|ZP_08328708.1| Dihydrodipicolinate reductase [gamma proteobacterium IMCC1989]
 gi|330420860|gb|EGG95139.1| Dihydrodipicolinate reductase [gamma proteobacterium IMCC1989]
          Length = 267

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 157/266 (59%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V G  GRMG+ LI+ I  +P     + I +  S LIG D G   GI   G+    ++
Sbjct: 4   RIAVTGAAGRMGKMLIEAIAVSPDAVFTAAIEQPHSSLIGADAGELAGIGKNGVMLVGDI 63

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D ++DF++P+ TL +    A +    +IGTTGFSV+E  V+       PI+K+
Sbjct: 64  AEVVNDFDVLVDFTAPSATLLNTECCAANGKGIVIGTTGFSVEELAVLEKMYSQLPIIKA 123

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S G+N    L+E AA  +    D D EI+E HHR K+D+PSGTAL++GE IA+    
Sbjct: 124 ANYSTGVNLSLKLLEMAASVM--GDDSDIEIVEAHHRHKVDAPSGTALVMGEVIADTLNR 181

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L+   V  R  Q  AR + +IG A++R G +VG+H+V+   EGE + ++H A  R  FA
Sbjct: 182 DLSKVAVYGREGQTGARDQETIGFATVRGGDVVGDHTVMFMAEGERLEITHKASSRMSFA 241

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG++ AA W   +  G YSM++VLG+
Sbjct: 242 RGAVRAAAWLSGKKNGFYSMQEVLGL 267


>gi|241664157|ref|YP_002982517.1| dihydrodipicolinate reductase [Ralstonia pickettii 12D]
 gi|240866184|gb|ACS63845.1| dihydrodipicolinate reductase [Ralstonia pickettii 12D]
          Length = 263

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 162/267 (60%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R GS  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGVTLGAALDRPGSDAVGQDAGVKLG-KTTGVIVTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL  LN++ +     +IGTTGF+ ++     ++  +  +V 
Sbjct: 60  VRAGLSQADVLIDFTRPDATLNHLNVARELGTAVVIGTTGFTAEQKASFKTYGESIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDVEIIEAHHKHKIDAPSGTALKMGEIVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R  +   R  G+IG A++R G IVG+H+V+ AG+GE I ++H +  R+ +
Sbjct: 178 TKLADRAVYAREGETGPRQLGTIGFATVRGGDIVGDHTVLFAGDGERIEITHRSNTRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA++   +  GLY M DVLG+
Sbjct: 238 AEGAVRAAVYVAGK-KGLYDMNDVLGL 263


>gi|16127780|ref|NP_422344.1| dihydrodipicolinate reductase [Caulobacter crescentus CB15]
 gi|14547954|sp|Q9A2L1|DAPB_CAUCR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|13425286|gb|AAK25512.1| dihydrodipicolinate reductase [Caulobacter crescentus CB15]
          Length = 257

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 159/269 (59%), Gaps = 19/269 (7%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P++I++ G  GRMG+A+ + +       + +   R G      D G        G+   +
Sbjct: 4   PVKIAIAGANGRMGRAVAQALEGRSDAVVAARFERPG------DAGE-------GLVARE 50

Query: 64  NLAMAIQSVDGIIDFSSPALTLQ-SLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
               A+ + + +IDF+ P  ++  +   +A      +IG+TGFS ++ + I + A    I
Sbjct: 51  T---ALAAAEAVIDFTLPEASVALAEEAAANGGPALVIGSTGFSDEQLDRIDAAATKIVI 107

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S N SLG+N L  LV  AA   LPA+DWD E+ E HH+RK+D+PSGTAL+LGEA A G
Sbjct: 108 VRSGNYSLGVNMLMGLVRQAA-AALPAQDWDIEVFEAHHKRKIDAPSGTALMLGEAAAEG 166

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R +NL       R      R +G IG + +R G I+GEHSV+ AGE ES+TLSHSA DR 
Sbjct: 167 RGINLAKVSDRGRDGVTGPRKDGDIGFSVVRGGGIIGEHSVIFAGESESLTLSHSAIDRG 226

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FARG++ AA+W K + PGLY M+DVLG 
Sbjct: 227 LFARGAIAAAVWVKGKPPGLYDMQDVLGF 255


>gi|187930052|ref|YP_001900539.1| dihydrodipicolinate reductase [Ralstonia pickettii 12J]
 gi|238691822|sp|B2UCA2|DAPB_RALPJ RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|187726942|gb|ACD28107.1| Dihydrodipicolinate reductase [Ralstonia pickettii 12J]
          Length = 263

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 162/267 (60%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R GS  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGVTLGAALDRPGSDAVGQDAGVKLG-KTTGVIVTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL  LN++ +     +IGTTGF+ ++     ++  +  +V 
Sbjct: 60  VRAGLSQADVLIDFTRPDATLNHLNVARELGTAVVIGTTGFTAEQKASFKTYGESIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDVEIIEAHHKHKIDAPSGTALKMGEIVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R  +   R  G+IG A++R G IVG+H+V+ AG+GE I ++H +  R+ +
Sbjct: 178 TKLADRAVYAREGETGPRELGTIGFATVRGGDIVGDHTVLFAGDGERIEITHRSNTRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA++   +  GLY M DVLG+
Sbjct: 238 AEGAVRAAVYVAGK-KGLYDMNDVLGL 263


>gi|167625075|ref|YP_001675369.1| dihydrodipicolinate reductase [Shewanella halifaxensis HAW-EB4]
 gi|189082805|sp|B0TQB8|DAPB_SHEHH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|167355097|gb|ABZ77710.1| Dihydrodipicolinate reductase [Shewanella halifaxensis HAW-EB4]
          Length = 271

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 156/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ GG GRMG+ LI+    N  I L + I R+GS L+G D G   G+  M +  +D+
Sbjct: 5   VRVAITGGSGRMGRTLIEAAKQNGIILLGAAIERAGSTLMGVDAGELAGVGSMNVAITDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF+SP  ++   +  A++    +IGTTGF+  + E IS++A   PIV 
Sbjct: 65  LDKAVNDFDVLIDFTSPEASVFHTDWCAKNGKAIVIGTTGFNHAQKEQISAYADQIPIVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NM++G+N +  L+E  AE +      D EI+E HHR K D+PSGTAL +GE IA    
Sbjct: 125 APNMAVGVNLMWKLLEVTAEVM--GHYCDIEIIEGHHRYKKDAPSGTALKMGEVIAETLG 182

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A  R  F
Sbjct: 183 RDLEKCAVYGREGMTGERDRETIGFATVRAGDIVGEHTALFADIGERLEITHKASSRMTF 242

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W   Q  GLY M+ VLG+
Sbjct: 243 ANGAMRAATWLVEQDAGLYDMQQVLGL 269


>gi|224825732|ref|ZP_03698836.1| Dihydrodipicolinate reductase [Lutiella nitroferrum 2002]
 gi|224601956|gb|EEG08135.1| Dihydrodipicolinate reductase [Lutiella nitroferrum 2002]
          Length = 266

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 155/267 (58%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M + ++G  GRMG+ LI+ +     + LH+ + R GS  IGQD G F+G    GIK + +
Sbjct: 2   MNVVIVGASGRMGRTLIESVLATEGLQLHAAVERPGSDFIGQDAGLFLG-QATGIKVTPD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A+Q  D +IDF+ P  TL  +     HN+  IIGTTGF     E I   +    IV 
Sbjct: 61  FDAALQGADVVIDFTRPEGTLHYMASCVAHNVKLIIGTTGFDEAGKEAIRQASEKIGIVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N    L++ A+  L  A+D+D EI+E HHR K+D+PSGTAL +GE IAN   
Sbjct: 121 APNFSVGVNLTFKLLDIASRVL--AEDYDIEIIEAHHRHKVDAPSGTALRMGEVIANALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      R   +IG A++RAG +VG+H+ + A  GE + ++H A  R  F
Sbjct: 179 RDLKECAVYGREGVTGERDAKTIGFATVRAGDVVGDHTALFATNGERVEITHKASSRATF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W  ++  GL+ M+DVLG+
Sbjct: 239 ANGAVRAAKWLSAKPTGLFDMQDVLGL 265


>gi|46201191|ref|ZP_00055589.2| COG0289: Dihydrodipicolinate reductase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 254

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 160/256 (62%), Gaps = 2/256 (0%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+ L++ +      TL     R+G+ ++G+D+G  +G  P+G     +     Q+ D +
Sbjct: 1   MGRMLMEAVLAAGGCTLSGGTERAGAEVLGRDLGTLLGREPVGALVGADARALFQASDAV 60

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF++PA TL    ++A+   V ++GTTG S  +   ++  A+ AP+V + N S+G+N L
Sbjct: 61  IDFTAPAATLAHAAMAAETGKVLVVGTTGLSKDDEARLAEAAKAAPMVYAPNFSVGVNLL 120

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L E AA  L   +D+D EI+EMHHR K+D+PSGTAL LG + A GR+V L      +R
Sbjct: 121 MALTERAAAIL--GEDYDIEIVEMHHRHKVDAPSGTALGLGRSAALGRQVALDSRWCKSR 178

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                AR +G IG A+LR G +VG+H+V+ A EGE + L+H A  R +FA+G++ AA WA
Sbjct: 179 DGHTGARPKGEIGFATLRGGDVVGDHTVMFAAEGERVELTHKASSRTVFAKGAVRAAQWA 238

Query: 256 KSQIPGLYSMRDVLGI 271
            +Q PGLYSMRDVLG+
Sbjct: 239 ATQSPGLYSMRDVLGL 254


>gi|254283630|ref|ZP_04958598.1| dihydrodipicolinate reductase [gamma proteobacterium NOR51-B]
 gi|219679833|gb|EED36182.1| dihydrodipicolinate reductase [gamma proteobacterium NOR51-B]
          Length = 273

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 154/267 (57%), Gaps = 4/267 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNP-SITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           R+ +LG  GRMG+ LI+ I  +P S+ L + + R  S L G D G  +G   +G+  S +
Sbjct: 4   RVGILGAAGRMGKMLIEAIAESPDSVVLAAALERPESTLQGADAGELIGSGAIGVVVSAD 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA A+Q +D +IDF++P  TL+S  + A   +  ++GTTG S  +     S      + K
Sbjct: 64  LAAALQRIDVLIDFTTPDATLESARLCADAGVAMVVGTTGLSSSQEAEFRSHGSRIALCK 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SN S G+N    L+  AA  +    D D +I+E HHR K+D+PSGTAL +GE +A+   
Sbjct: 124 ASNFSSGVNVAFKLIAEAARAM--GDDVDIDIIEAHHRHKVDAPSGTALSMGEVVADTLG 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L+   V  R  Q  AR    IG A++R G IVG+H+V+ A +GE + ++H A  R  F
Sbjct: 182 RDLSQVAVYGREGQTGARPREQIGFATIRGGDIVGDHTVLFAADGERLEITHKASSRMAF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AA W   Q  G Y M+DVLG 
Sbjct: 242 ARGAVRAAAWVAQQPAGCYDMQDVLGF 268


>gi|307824246|ref|ZP_07654472.1| dihydrodipicolinate reductase [Methylobacter tundripaludum SV96]
 gi|307734626|gb|EFO05477.1| dihydrodipicolinate reductase [Methylobacter tundripaludum SV96]
          Length = 267

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 157/268 (58%), Gaps = 5/268 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI+V+G  GRMG  LIK    +    L   + R  S  IG+D G   GIS +G+K  D+
Sbjct: 2   MRIAVVGASGRMGLCLIKAAALDKKAELAVAVSRPESLAIGRDAGELAGISVVGVKVVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  +   D +IDF+ P  ++  +    Q     +IGTTG+S  +  +IS  A++  IV 
Sbjct: 62  LASVVDQFDVLIDFTRPDASMAFIETCRQAGKKLVIGTTGYSDAQKALISEAAKDVAIVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NMS+G+N    L+E  A+ +    D+ D E++E HHR K+D+PSGTAL +GE IA+  
Sbjct: 122 APNMSVGVNLSLKLLEMTAKVM---GDYTDIEVIEAHHRHKVDAPSGTALRMGEVIADAL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L D  +  R      R   +IG +++RAG IVGEH+V+ A +GE + ++H A  R  
Sbjct: 179 GRDLKDCAIYGREGNTGERDRKTIGFSTIRAGDIVGEHTVMFADDGERVEITHKATSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 FANGAVRAAVWLADKDSGLYDMQDVLGL 266


>gi|167855598|ref|ZP_02478358.1| dihydrodipicolinate reductase [Haemophilus parasuis 29755]
 gi|167853289|gb|EDS24543.1| dihydrodipicolinate reductase [Haemophilus parasuis 29755]
          Length = 270

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 153/266 (57%), Gaps = 3/266 (1%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I V+G  GRMG+ LI+ ++N   + L +   R GS L+G D G   GI  +G+  +D
Sbjct: 2   TLKIGVVGADGRMGRQLIQAVNNAEGVELGAAFERKGSSLVGADAGELAGIGHLGVTVTD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +LA  +   D +IDF+ P  TL+ +     HN   +IGTTGF     + I S +    IV
Sbjct: 62  DLASQLNHFDLLIDFTRPEGTLEHIAFCVAHNKKMVIGTTGFDDAGKQAIKSASEKISIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 180 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W +++  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLQTKQNGLFDMTDVL 265


>gi|107021728|ref|YP_620055.1| dihydrodipicolinate reductase [Burkholderia cenocepacia AU 1054]
 gi|116688674|ref|YP_834297.1| dihydrodipicolinate reductase [Burkholderia cenocepacia HI2424]
 gi|123072418|sp|Q1BZ73|DAPB_BURCA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166222617|sp|A0K4H7|DAPB_BURCH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|105891917|gb|ABF75082.1| dihydrodipicolinate reductase [Burkholderia cenocepacia AU 1054]
 gi|116646763|gb|ABK07404.1| dihydrodipicolinate reductase [Burkholderia cenocepacia HI2424]
          Length = 265

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    G+K +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPFLGQDAGAFLG-KDTGVKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       + +IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQAEYLIDFTRPEGTMAHIEAALRHDVKLVIGTTGFTAEQKADLQAAAARIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAQHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   SIG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSSIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|167564103|ref|ZP_02357019.1| dihydrodipicolinate reductase [Burkholderia oklahomensis EO147]
 gi|167571245|ref|ZP_02364119.1| dihydrodipicolinate reductase [Burkholderia oklahomensis C6786]
          Length = 265

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 160/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ +   P  TL   + R+ SP +GQD G F+G    GI  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRADSPQLGQDAGAFLG-KQTGIALTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  + E + +      +V 
Sbjct: 60  LERVCAEADYLIDFTRPEGTLVHLDAALRHDVKLVIGTTGFSEPQKESLRAAGEKIALVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA    
Sbjct: 120 SANMSVGVNVTMKLLEFAAKQF--AQGYDIEIVEAHHRHKVDAPSGTALMMGETIAAALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+GSL AA +      G + M+DVLG+
Sbjct: 238 AQGSLRAARFLAGHATGFFDMQDVLGL 264


>gi|332524697|ref|ZP_08400896.1| dihydrodipicolinate reductase [Rubrivivax benzoatilyticus JA2]
 gi|332108005|gb|EGJ09229.1| dihydrodipicolinate reductase [Rubrivivax benzoatilyticus JA2]
          Length = 267

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 163/269 (60%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P+ I+V G  GRMG+ L++ +  +    L   +   GSP +GQD G F+G +  G+  +
Sbjct: 2   NPVAIAVAGASGRMGRMLVEAVLGSEGCRLSGALDVPGSPALGQDAGAFLGRT-TGVAVT 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L   +   D +IDF+ P  TL  L +  +  +  +IGTTGF+ ++   I++ A+   I
Sbjct: 61  ADLRAGLAGADVLIDFTRPEGTLAHLALCRELGVRMVIGTTGFTPQQKAEIAAAAQQVGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N +  L+ETAA+ L  A  +D EI+E HHR K+D+PSGTAL +GEA+A  
Sbjct: 121 VFAPNMSVGVNVVLKLLETAAKAL--ADGYDIEIVEAHHRHKVDAPSGTALAMGEAVARA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L++H V  R      R  G+IG A++R G IVG+H+V+ AG GE I +SH +  R 
Sbjct: 179 LGQDLSEHAVFAREGHTGERQPGTIGFATIRGGDIVGDHTVLFAGTGERIEISHRSNSRA 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A GS+ AA +     PGLY M DVLG+
Sbjct: 239 NYAAGSVRAARFLVEHGPGLYGMADVLGL 267


>gi|253702727|ref|YP_003023916.1| dihydrodipicolinate reductase [Geobacter sp. M21]
 gi|259586133|sp|C6E9Q8|DAPB_GEOSM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|251777577|gb|ACT20158.1| dihydrodipicolinate reductase [Geobacter sp. M21]
          Length = 267

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 165/271 (60%), Gaps = 11/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMG  +I  +     + +   + R G P++GQD G   G+  +G+  SD+
Sbjct: 2   VKIAVCGAAGRMGGRIIAAVKEAEGVEICGALERPGHPMVGQDAGYNAGLGAIGVAISDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +Q+ D +IDF++P ++L++L + A +    +IG+TGF+ +E  + +  AR+ P++ 
Sbjct: 62  LNAVVQACDVLIDFTAPKVSLKNLEVCALYGKSIVIGSTGFTPEERALAAELARDIPVII 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    ++   A+ L   +D+D EI+E HHR K DSPSGTA+ +GE +A   G
Sbjct: 122 APNMSVGVNVCFKVLADVAKIL--GEDFDVEIVESHHRLKKDSPSGTAVRMGEVVAGALG 179

Query: 183 RKVNLTDHMVLNRHIQQ-CA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT   IG+ ++R G IVGEH+V   G GE I ++H A+ 
Sbjct: 180 RDYN----KVANYHREGICGERTHDEIGMQTVRGGDIVGEHTVYFIGMGERIEITHRAHT 235

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RGS+ AA W  +   G+Y M+DVLG+
Sbjct: 236 RDMFSRGSVRAAKWVVTAKQGVYDMQDVLGL 266


>gi|218547477|ref|YP_002381268.1| dihydrodipicolinate reductase [Escherichia fergusonii ATCC 35469]
 gi|226724142|sp|B7LWM1|DAPB_ESCF3 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|218355018|emb|CAQ87624.1| dihydrodipicolinate reductase [Escherichia fergusonii ATCC 35469]
          Length = 273

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALGLEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A++
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDDAGKQAIGEAAKD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW K +  GL+ M+DVL +
Sbjct: 238 SSRMTFANGAVRSALWLKGKDKGLFDMKDVLNL 270


>gi|324112569|gb|EGC06546.1| dihydrodipicolinate reductase [Escherichia fergusonii B253]
 gi|325495960|gb|EGC93819.1| dihydrodipicolinate reductase [Escherichia fergusonii ECD227]
          Length = 273

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALGLEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A++
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDDAGKQAIGEAAKD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW K +  GL+ M+DVL +
Sbjct: 238 SSRMTFANGAVRSALWLKGKDKGLFDMKDVLNL 270


>gi|59711078|ref|YP_203854.1| dihydrodipicolinate reductase [Vibrio fischeri ES114]
 gi|197334705|ref|YP_002155226.1| dihydrodipicolinate reductase [Vibrio fischeri MJ11]
 gi|75431817|sp|Q5E7N0|DAPB_VIBF1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226696363|sp|B5FA64|DAPB_VIBFM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|59479179|gb|AAW84966.1| dihydrodipicolinate reductase [Vibrio fischeri ES114]
 gi|197316195|gb|ACH65642.1| dihydrodipicolinate reductase [Vibrio fischeri MJ11]
          Length = 269

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 156/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G  GRMG+ LIK ++ +    L +   R  S LIG DVG   G+   GI   D+
Sbjct: 2   VRVAIAGAAGRMGRNLIKAVNGSQFAVLAAASERPESSLIGVDVGEMAGLGKSGILIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D IIDF+ P  TL+++ +  +HN   +IGTTGFS    E+I   ++  P+V 
Sbjct: 62  LAKVTDDFDVIIDFTLPISTLKNIELCQEHNKAIVIGTTGFSEPGKEIIDQASKEIPVVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 122 APNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRYKVDAPSGTAIGMGEAIAGAMG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      R++  IG A++RAG IVGEH+ + A  GE + ++H A DR  F
Sbjct: 180 NKLEDVAVYAREGITGERSKDEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ A+ W   + PG Y+M DVL +
Sbjct: 240 ANGAVRASHWLHKKEPGFYTMHDVLNL 266


>gi|332160249|ref|YP_004296826.1| dihydrodipicolinate reductase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664479|gb|ADZ41123.1| dihydrodipicolinate reductase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863042|emb|CBX73174.1| dihydrodipicolinate reductase [Yersinia enterocolitica W22703]
          Length = 273

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 159/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + R GS L+G D G   G   + I
Sbjct: 1   MTNSTIRIAVVGAGGRMGRQLIQAITQTKGVVLGAAVERPGSSLVGSDAGELAGAGLLNI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D+L   I   D +IDF+ P  TL+ L I   H    IIGTTGF       I + A +
Sbjct: 61  TVNDDLTKVIDDFDVLIDFTRPEGTLEHLAICRTHRKAMIIGTTGFDDAGKAAIRAAASD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAESLGRSLKDCAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W  +   GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWLSNHDNGLFDMRDVLSL 270


>gi|170731971|ref|YP_001763918.1| dihydrodipicolinate reductase [Burkholderia cenocepacia MC0-3]
 gi|254246340|ref|ZP_04939661.1| dihydrodipicolinate reductase [Burkholderia cenocepacia PC184]
 gi|238688588|sp|B1JVG6|DAPB_BURCC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|124871116|gb|EAY62832.1| dihydrodipicolinate reductase [Burkholderia cenocepacia PC184]
 gi|169815213|gb|ACA89796.1| Dihydrodipicolinate reductase [Burkholderia cenocepacia MC0-3]
          Length = 265

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    G+K +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPFLGQDAGAFLG-KDTGVKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       + +IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQAEYLIDFTRPEGTMAHVEAALRHDVKLVIGTTGFTAEQKADLQAAAARIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   SIG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSSIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|172059633|ref|YP_001807285.1| dihydrodipicolinate reductase [Burkholderia ambifaria MC40-6]
 gi|238689173|sp|B1YT08|DAPB_BURA4 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|171992150|gb|ACB63069.1| Dihydrodipicolinate reductase [Burkholderia ambifaria MC40-6]
          Length = 265

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    G+K +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDSDAQLVGALDRAGSPFLGQDAGAFLG-KETGVKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQADYLIDFTRPEGTIAHVAAALRHDVKLVIGTTGFTAEQKAELQAAAARIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLEDCAVYGRHGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|53720549|ref|YP_109535.1| dihydrodipicolinate reductase [Burkholderia pseudomallei K96243]
 gi|76810338|ref|YP_334826.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1710b]
 gi|217420634|ref|ZP_03452139.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 576]
 gi|237813820|ref|YP_002898271.1| dihydrodipicolinate reductase [Burkholderia pseudomallei MSHR346]
 gi|242317255|ref|ZP_04816271.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1106b]
 gi|254180640|ref|ZP_04887238.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1655]
 gi|254199016|ref|ZP_04905431.1| dihydrodipicolinate reductase [Burkholderia pseudomallei S13]
 gi|254262042|ref|ZP_04953096.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1710a]
 gi|254299274|ref|ZP_04966724.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 406e]
 gi|284159921|ref|YP_001060429.2| dihydrodipicolinate reductase [Burkholderia pseudomallei 668]
 gi|81607711|sp|Q63QT3|DAPB_BURPS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|90101230|sp|Q3JNM7|DAPB_BURP1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|52210963|emb|CAH36951.1| dihydrodipicolinate reductase [Burkholderia pseudomallei K96243]
 gi|76579791|gb|ABA49266.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1710b]
 gi|157809220|gb|EDO86390.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 406e]
 gi|169656846|gb|EDS88243.1| dihydrodipicolinate reductase [Burkholderia pseudomallei S13]
 gi|184211179|gb|EDU08222.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1655]
 gi|217396046|gb|EEC36063.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 576]
 gi|237503607|gb|ACQ95925.1| dihydrodipicolinate reductase [Burkholderia pseudomallei MSHR346]
 gi|242140494|gb|EES26896.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1106b]
 gi|254220731|gb|EET10115.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1710a]
 gi|283775109|gb|ABN84203.2| dihydrodipicolinate reductase [Burkholderia pseudomallei 668]
          Length = 268

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 160/269 (59%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M+I++ G  GRMG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +
Sbjct: 2   SSMKIAIAGASGRMGRMLIEAVLAAPDATLAGALDRTGSPQLGQDAGAFLG-KQTGVALT 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +
Sbjct: 61  DDIERVCAEADYLIDFTRPEGTLAHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGGKIAL 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA  
Sbjct: 121 VFSANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
               L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R 
Sbjct: 179 TGRTLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRV 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+G+L AA +      G + M+DVLG+
Sbjct: 239 SYAQGALRAARFLAGHQAGFFDMQDVLGL 267


>gi|323527347|ref|YP_004229500.1| dihydrodipicolinate reductase [Burkholderia sp. CCGE1001]
 gi|323384349|gb|ADX56440.1| dihydrodipicolinate reductase [Burkholderia sp. CCGE1001]
          Length = 265

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 160/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+   TL   + R+GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDSDATLSGALDRAGSPQLGQDAGAFLG-KQTGVALTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L  + +HN+  +IGTTGF   +   + + A    I+ 
Sbjct: 60  IERVFAESDYLIDFTRPEGTLMHLEAAQRHNVKMVIGTTGFDNAQKAQLRAAADKIAIMF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SNMS+G+N    L+E AA++   A  +D EI+E HHR K+D+PSGTAL +GE IAN   
Sbjct: 120 ASNMSVGVNVTLKLLEFAAKHF--ATGYDIEIIEAHHRHKVDAPSGTALTMGEVIANALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  V +R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RNLDDCAVYSREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  + +    G + M+DVLG+
Sbjct: 238 AQGALRAVRFLEGHETGFFDMQDVLGL 264


>gi|113460978|ref|YP_719045.1| dihydrodipicolinate reductase [Haemophilus somnus 129PT]
 gi|123327296|sp|Q0I3N1|DAPB_HAES1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|112823021|gb|ABI25110.1| dihydrodipicolinate reductase [Haemophilus somnus 129PT]
          Length = 270

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 156/268 (58%), Gaps = 3/268 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI+ +++   + L +   R GS L+G D G   G+  +GIK SD
Sbjct: 2   TLKIGIVGAGGRMGRQLIQAVYHTEGVELGAAFERVGSSLVGTDAGELAGVGKLGIKVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           NL     + D ++DF+ P  TLQ L    +H+   +IGTTGF  +  + I   A+N  IV
Sbjct: 62  NLTQEKDNFDLLVDFTRPEGTLQHLAFCVEHHKNIVIGTTGFDDQSKQAIQQAAQNIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L++ AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLKKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V +R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFSREGITGERKPDEIGFSTIRAADVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W  ++  GL+ M DVL +
Sbjct: 240 FANGAVRAAKWLSTKQEGLFDMTDVLDL 267


>gi|206561713|ref|YP_002232478.1| dihydrodipicolinate reductase [Burkholderia cenocepacia J2315]
 gi|238693127|sp|B4EEW4|DAPB_BURCJ RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|198037755|emb|CAR53699.1| dihydrodipicolinate reductase [Burkholderia cenocepacia J2315]
          Length = 265

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    GIK +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPFLGQDAGAFLG-KDTGIKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       + +IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQAEYLIDFTRPEGTMAHIAAALRHDVKLVIGTTGFTAEQKAELQAAAGKIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   SIG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSSIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|206603528|gb|EDZ40008.1| Dihydrodipicolinate reductase [Leptospirillum sp. Group II '5-way
           CG']
          Length = 265

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 166/273 (60%), Gaps = 11/273 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G  GRMG+A+ + +  NP  TL + IV +  P+ G+ V    G+      ++ +
Sbjct: 2   LRVALVGAAGRMGKAIQEVLEKNPGTTLSAAIVEANDPMNGKPVLFGEGV------YTSS 55

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A++  D  IDFS  A  L+++   ++     +IGTTGFS KE E I       P++ 
Sbjct: 56  LEEALEKSDVGIDFSEVASALETVEAFSRSGRPLVIGTTGFSAKEKERIYQAGERIPLIL 115

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGI+ L +LV+ AAE L     +D EI+E HHR K D+PSGTAL LGE++A+ R 
Sbjct: 116 SPNMSLGIHLLSYLVKIAAEKL---PSYDAEIVETHHRMKKDAPSGTALFLGESLASARG 172

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D    +R      R + SIGI ++R G +VG+H+V   GEGE + L+H A  R  F
Sbjct: 173 KRLGDVGTYHREGMTGVRPQDSIGIMAMRGGDVVGDHTVFFLGEGERLELTHRATSRETF 232

Query: 245 ARGSLTAALW-AKSQIPGLYSMRDVLGIGLDKE 276
           ARG++ AA++ A+ + PG+Y+M DVLG+  +K+
Sbjct: 233 ARGAVEAAVFLARRKNPGVYTMNDVLGLENEKK 265


>gi|319943261|ref|ZP_08017544.1| dihydrodipicolinate reductase [Lautropia mirabilis ATCC 51599]
 gi|319743803|gb|EFV96207.1| dihydrodipicolinate reductase [Lautropia mirabilis ATCC 51599]
          Length = 270

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 158/272 (58%), Gaps = 5/272 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ +   P + L S + RS SP +G D G F+G+   G+  +D+
Sbjct: 1   MKIAITGASGRMGRMLIEAVLAAPDMELASALDRSDSPALGTDAGAFMGVK-TGVTITDH 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A+     +IDF+ P  ++  L+   QH +  +IGTTGFS +E   I   A++  IV+
Sbjct: 60  TDAALAGCQVLIDFTRPEASMVYLDACRQHGVKMVIGTTGFSAEERARIQQAAQDIAIVQ 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS G+N    L+E A + L    D D E++E HHR K+D+PSGTAL +GEAIA    
Sbjct: 120 AANMSPGVNAAIRLIELATQML---TDTDIEVIEAHHRHKVDAPSGTALAIGEAIAAQLG 176

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L +  V  R      R  GSIG +++R G IVG+H+V+ AG GE I + H A  R  +
Sbjct: 177 KPLAEIGVFTREGHTGPRQPGSIGFSTIRGGDIVGDHTVLFAGNGEQIEIRHRATSRAHY 236

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGIGLDKE 276
           A GSL A  +   +  GLY MR VLG+   K+
Sbjct: 237 ADGSLRACRFLADKAHGLYDMRAVLGLSSGKQ 268


>gi|134294731|ref|YP_001118466.1| dihydrodipicolinate reductase [Burkholderia vietnamiensis G4]
 gi|166222623|sp|A4JBH8|DAPB_BURVG RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|134137888|gb|ABO53631.1| dihydrodipicolinate reductase [Burkholderia vietnamiensis G4]
          Length = 265

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G FVG    GIK +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPFLGQDAGAFVG-KDTGIKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQADYLIDFTRPEGTIAHIEAALRHDVKLVIGTTGFTAEQKAQLQAAAAKLGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAQHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   SIG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSSIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|260463376|ref|ZP_05811577.1| dihydrodipicolinate reductase [Mesorhizobium opportunistum WSM2075]
 gi|259030966|gb|EEW32241.1| dihydrodipicolinate reductase [Mesorhizobium opportunistum WSM2075]
          Length = 259

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 162/274 (59%), Gaps = 19/274 (6%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M Q P+RI++ G  GRMG+ +   +  +P + L +   R G+      VG+       G+
Sbjct: 1   MPQPPIRIAIAGALGRMGRQMTDAVRADPRLALAARFHRPGA------VGD-------GL 47

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQ-SLNISAQHNIVHIIGTTGFSVKENEVISSFAR 118
              +    A+ + D +IDF++PA +   +   +A+     +IG+TGF   E   I+  A+
Sbjct: 48  VSREE---ALAAADVVIDFTTPAASADLARFCAARGGPALVIGSTGFDATEFADIAEAAK 104

Query: 119 NAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEA 178
              IV+S + SLG+N L  LVE AA  L P +DWD E+ E HHR K+D+PSGTAL+LG+A
Sbjct: 105 IIAIVRSGSFSLGLNMLVGLVEQAATALDP-EDWDAEVFEAHHRHKIDAPSGTALMLGQA 163

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           +A GRKV L       R     AR  G IG A +R GSIVGEHSV    EGE++TLSH+A
Sbjct: 164 VAGGRKVELDAVARRVRDGVTGARPAGEIGFAVVRGGSIVGEHSVSFCTEGETVTLSHAA 223

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGIG 272
            DR +FARG++ AALW   + PG Y MRDVLG G
Sbjct: 224 GDRIMFARGAIAAALWVAGRHPGEYDMRDVLGFG 257


>gi|304396525|ref|ZP_07378406.1| dihydrodipicolinate reductase [Pantoea sp. aB]
 gi|304356034|gb|EFM20400.1| dihydrodipicolinate reductase [Pantoea sp. aB]
          Length = 271

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 157/271 (57%), Gaps = 3/271 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + +RI+++G  GRMG+ LI        + L + + R GS LIG D G   GI   GI  +
Sbjct: 2   NTIRIAIVGAPGRMGRNLILATQQAEGVELGAALARPGSSLIGSDAGELAGIGKNGILIA 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+L       D +IDF+ P  TL+ + I  +H    +IGTTGF       I + A +  I
Sbjct: 62  DDLRAVTNDFDVLIDFTRPEGTLEYMAICREHGKAMVIGTTGFDEAGKAAIRAAAEDIAI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N +  L+E AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAIA+ 
Sbjct: 122 VFAANFSVGVNLVLKLLEKAAKVM--GEYADIEIVEAHHRHKVDAPSGTALAMGEAIADA 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
            +  L +H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A  R 
Sbjct: 180 MQWKLDEHAVYTREGYTGERQPQTIGFATVRAGDIVGEHTAMFADIGERVEITHKASSRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGIGL 273
            FA G++ +ALW K +  GL+ MRDVL + +
Sbjct: 240 TFANGAVKSALWLKDKKSGLFDMRDVLDLSM 270


>gi|317493343|ref|ZP_07951765.1| dihydrodipicolinate reductase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918736|gb|EFV40073.1| dihydrodipicolinate reductase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 273

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 154/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+
Sbjct: 1   MSNSQIRIAVAGAGGRMGRQLISAVANTDGVVLGAAFEREGSSLLGVDAGELAGIGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             S +L  A  S D +IDF+ P  TL  L    + +   +IGTTGF       I   A +
Sbjct: 61  VVSSSLQDAADSFDVLIDFTRPEGTLSHLEFCVKQHKNMVIGTTGFDDAGKAAIRQAAES 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE 
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGET 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L +  V +R      R   SIG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAQALGRDLKECAVYSREGYTGERDPKSIGFATIRAGDIVGEHTAMFADVGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA W  ++  GLY MRDVL +
Sbjct: 238 SSRMTFASGAVRAAAWIGTRATGLYDMRDVLSL 270


>gi|77166261|ref|YP_344786.1| dihydrodipicolinate reductase [Nitrosococcus oceani ATCC 19707]
 gi|254435944|ref|ZP_05049451.1| dihydrodipicolinate reductase [Nitrosococcus oceani AFC27]
 gi|90101245|sp|Q3J7E0|DAPB_NITOC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|76884575|gb|ABA59256.1| dihydrodipicolinate reductase [Nitrosococcus oceani ATCC 19707]
 gi|207089055|gb|EDZ66327.1| dihydrodipicolinate reductase [Nitrosococcus oceani AFC27]
          Length = 271

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 154/267 (57%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G  GRMG++LI+       ITL +      S LIG D G    +  + I   D+
Sbjct: 2   IRVAISGAAGRMGRSLIQAACQYEGITLGAASEYPDSHLIGSDAGEVARVGALQIPLVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L    ++ D +IDF+ P +++ +L +        ++GTTGF+ ++ + I+  A   PIV 
Sbjct: 62  LGKNKEAFDLLIDFTRPEVSMANLVLCRDQGKAMVVGTTGFTKEQRQEITRAAIEIPIVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA  L    D D EI+E HHR K+DSPSGTAL +GE +A    
Sbjct: 122 APNMSVGVNLCLKLLEMAASVL--KDDVDIEIIEAHHRHKVDSPSGTALRMGEVVAETLG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL    +  R   +  R   SIG +SLRAG IVGEH+V+ A EGE I +SH A  R  F
Sbjct: 180 RNLDQCAIYGRQGLRSERPRESIGFSSLRAGDIVGEHTVIFAAEGERIEISHKASSRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ A+ W   + PGLY M+DVLG+
Sbjct: 240 ALGAMRASQWVSDKPPGLYDMQDVLGL 266


>gi|83719010|ref|YP_441755.1| dihydrodipicolinate reductase [Burkholderia thailandensis E264]
 gi|123537540|sp|Q2SZ94|DAPB_BURTA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|83652835|gb|ABC36898.1| dihydrodipicolinate reductase [Burkholderia thailandensis E264]
          Length = 268

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 162/269 (60%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M+I++ G  GRMG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +
Sbjct: 2   SSMKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLG-KQTGVALT 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +
Sbjct: 61  DDIERVCAEADYLIDFTLPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIAL 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA  
Sbjct: 121 VFSANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R 
Sbjct: 179 TGRSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRV 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+G+L AA +   +  G + M+DVLG+
Sbjct: 239 SYAQGALRAARFLAGRDAGFFDMQDVLGL 267


>gi|77920016|ref|YP_357831.1| dihydrodipicolinate reductase [Pelobacter carbinolicus DSM 2380]
 gi|90101247|sp|Q3A1U6|DAPB_PELCD RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|77546099|gb|ABA89661.1| dihydrodipicolinate reductase [Pelobacter carbinolicus DSM 2380]
          Length = 267

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 160/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++++V G  GRMG  LI  I     + L   +  + SP++GQD G   G  P+ +  S +
Sbjct: 2   IKVAVNGAAGRMGGRLITAIKETEGLQLTGALEHAESPMLGQDAGLTAGCGPLDVLISSD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +++ D +IDF+ P ++L++L    +H+   +IG+TGF+ ++   +   A+N P+V 
Sbjct: 62  LDEVLKATDVLIDFTFPEVSLRNLEACVRHDKSIVIGSTGFTPEQRARVDEMAQNIPVVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L++ AA+ L     +D EI+E+HH +K DSPSGTA+ +GE +A+   
Sbjct: 122 APNMSVGVNACFKLLKEAAQIL--GDGFDVEIVELHHNKKKDSPSGTAVRMGEIVADALG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +     V +R     ART   IG+ ++R G IVGEH+V   G GE I ++H A  R +F
Sbjct: 180 RDYNKSAVYHREGMCGARTPEEIGMQTVRGGDIVGEHTVYFIGMGERIEITHRAMSRDMF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AA W   + PGLY M+D+LG+
Sbjct: 240 ARGAVRAASWLAGKAPGLYDMQDILGL 266


>gi|167618680|ref|ZP_02387311.1| dihydrodipicolinate reductase [Burkholderia thailandensis Bt4]
          Length = 265

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 161/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLG-KQTGVALTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +V 
Sbjct: 60  IERVCAEADYLIDFTRPEGTLVHLDAALRHDVKLVIGTTGFSESQKAQLRAAGEKIALVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA    
Sbjct: 120 SANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L AA +   +  G + M+DVLG+
Sbjct: 238 AQGALRAARFLAGRDAGFFDMQDVLGL 264


>gi|297539183|ref|YP_003674952.1| dihydrodipicolinate reductase [Methylotenera sp. 301]
 gi|297258530|gb|ADI30375.1| dihydrodipicolinate reductase [Methylotenera sp. 301]
          Length = 269

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 167/269 (62%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P+++ + G  GRMG AL++ +  +  + LH  + RSG+P +G+D G   G    G+K +
Sbjct: 3   NPLKVVIAGCSGRMGHALLECVFADTDLVLHGALDRSGNPQLGRDAGEQQG-KITGVKVT 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++  A+ + D ++DF+ P  +L  L    +HN+  IIGTTGFS ++  +I + ++N  I
Sbjct: 62  DSIDEALINADILVDFTRPEASLMYLAACQKHNVKMIIGTTGFSAEQKLLIEAASKNIAI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + N S+G++ L  LV++AA+ L   + +D EI+E HHR K+D+PSGTAL LGEA A+ 
Sbjct: 122 VFAPNTSVGVSLLINLVQSAAKVL--NEGFDIEIIEAHHRFKVDAPSGTALRLGEAAASA 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              NL +  V  R      R   +IG A++R G +VG+H+V+ AG GE + L+H A  R 
Sbjct: 180 LGRNLEECAVYGREGVTGERDPSTIGFATVRGGDVVGDHTVLFAGLGERVELTHKASSRA 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G+L AA +   +  GL+ M+DVLG+
Sbjct: 240 TFASGALRAAKFLIGKQTGLFDMQDVLGL 268


>gi|123440984|ref|YP_001004973.1| dihydrodipicolinate reductase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166224187|sp|A1JJE5|DAPB_YERE8 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|122087945|emb|CAL10733.1| dihydrodipicolinate reductase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 273

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/273 (40%), Positives = 160/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + R+GS L+G D G   G   + I
Sbjct: 1   MTNSTIRIAVVGAGGRMGRQLIQAITQTKGVVLGAAVERAGSTLVGSDAGELAGTGLLNI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L+      D +IDF+ P  TL+ L I   H+   +IGTTGF       IS+ +  
Sbjct: 61  AVSDDLSKVTDHFDVLIDFTRPEGTLEHLAICRAHHKAMVIGTTGFDDAGKAAISAASAE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRYKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V  R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAESLGRSLKDCAVYTREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W  +   GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWLSNHDNGLFDMRDVLSL 270


>gi|309781280|ref|ZP_07676016.1| dihydrodipicolinate reductase [Ralstonia sp. 5_7_47FAA]
 gi|308919693|gb|EFP65354.1| dihydrodipicolinate reductase [Ralstonia sp. 5_7_47FAA]
          Length = 263

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 161/267 (60%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R  S  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGVTLGAALDRPASDAVGQDAGVKLG-KTTGVIVTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL  LN++ +     +IGTTGF+ ++     ++  +  +V 
Sbjct: 60  VRAGLSQADVLIDFTRPDATLNHLNVARELGTAVVIGTTGFTAEQKASFKTYGESIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDVEIIEAHHKHKIDAPSGTALKMGEIVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R  +   R  G+IG A++R G IVG+H+V+ AG+GE I ++H +  R+ +
Sbjct: 178 TKLADRAVYAREGETGPRQLGTIGFATVRGGDIVGDHTVLFAGDGERIEITHRSNTRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA++   +  GLY M DVLG+
Sbjct: 238 AEGAVRAAVYVAGK-KGLYDMNDVLGL 263


>gi|294634966|ref|ZP_06713483.1| dihydrodipicolinate reductase [Edwardsiella tarda ATCC 23685]
 gi|291091565|gb|EFE24126.1| dihydrodipicolinate reductase [Edwardsiella tarda ATCC 23685]
          Length = 272

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 111/267 (41%), Positives = 149/267 (55%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++V G GGRMG+ LI      P +TL + + R GS L+G D G   G   +G+    +
Sbjct: 5   IRVAVAGAGGRMGRQLIAAAQAMPGVTLGAALEREGSSLLGCDAGELAGCGTLGVPVETD 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  +   D +IDF+ P  TL  L    Q     +IGTTGFS  E   I + A    IV 
Sbjct: 65  LARVVDRFDVLIDFTRPEATLAHLAFCQQQGKAMVIGTTGFSEDEKAAIHAAAHEIAIVF 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N +  L+E A++ +      D EI+E HHR K+D+PSGTAL +GE IA    
Sbjct: 125 AANFSVGVNVMLRLLEKASKVM--GDYCDIEIVEAHHRHKVDAPSGTALAMGETIAASLG 182

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V +R      R  GSIG A+LRAG IVGEH  + A  GE + ++H A  R  F
Sbjct: 183 RSLASCAVYSRQGHTGERVPGSIGFATLRAGDIVGEHCAIFADIGERLEITHKASSRMTF 242

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AALW   Q  GLY M DVL +
Sbjct: 243 ASGALRAALWVARQPVGLYDMCDVLAL 269


>gi|330815524|ref|YP_004359229.1| Dihydrodipicolinate reductase [Burkholderia gladioli BSR3]
 gi|327367917|gb|AEA59273.1| Dihydrodipicolinate reductase [Burkholderia gladioli BSR3]
          Length = 265

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 159/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+   TL   + R GS  +GQD G F+G  P G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDADATLVGALGRPGSAHLGQDAGAFLG-KPTGVAITDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  T+  L+ + +H +  +IGTTGFS  +   +   A    IV 
Sbjct: 60  VERVFAEADCLIDFTRPDTTIGYLDAARRHGVKLVIGTTGFSEAQKAQLREAASQVGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA     A+ +D EI+E HHR K+D+PSGTAL++GE +A    
Sbjct: 120 SANMSVGVNVTLKLLEFAARQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETVAASLG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V +RH +   R   +IG  ++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RKLEDCAVYDRHGETGPRDPSTIGFTAIRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+GS+ A  +   +  GL+ M+DVLG+
Sbjct: 238 AQGSMRAVRFLADKPAGLFDMQDVLGL 264


>gi|238026212|ref|YP_002910443.1| dihydrodipicolinate reductase [Burkholderia glumae BGR1]
 gi|237875406|gb|ACR27739.1| Dihydrodipicolinate reductase [Burkholderia glumae BGR1]
          Length = 265

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 162/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+P  TL   + R GS  +GQD G F+G  P G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDPDATLAGALGRPGSAHLGQDAGAFLG-KPTGVIVTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L+ + +H +  +IGTTGFS  +   + + A    +V 
Sbjct: 60  VERVFADADYLIDFTRPDTTLGYLDAAQRHGVKLVIGTTGFSEPQKARLRAAAARIGMVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE +A    
Sbjct: 120 SANMSVGVNVTLKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETVAASLG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V +RH +   R   +IG  ++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RQLADCAVYDRHGETGPRDPSTIGFTAIRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+GS+ A  +   +  GL+ M+DVLG+
Sbjct: 238 AQGSMRAVRFLADKPSGLFDMQDVLGL 264


>gi|237729327|ref|ZP_04559808.1| dihydrodipicolinate reductase [Citrobacter sp. 30_2]
 gi|226909056|gb|EEH94974.1| dihydrodipicolinate reductase [Citrobacter sp. 30_2]
          Length = 273

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 155/271 (57%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A+ 
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLAHLAFCRQHGKGMVIGTTGFDDAGKQAIRDAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L +  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALDKDLKECAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +A+W KS+  GL+ M+DVL
Sbjct: 238 SSRMTFANGAVRSAIWLKSKSNGLFDMKDVL 268


>gi|126453652|ref|YP_001067690.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1106a]
 gi|167721231|ref|ZP_02404467.1| dihydrodipicolinate reductase [Burkholderia pseudomallei DM98]
 gi|167740204|ref|ZP_02412978.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 14]
 gi|167817419|ref|ZP_02449099.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 91]
 gi|167825825|ref|ZP_02457296.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 9]
 gi|167847309|ref|ZP_02472817.1| dihydrodipicolinate reductase [Burkholderia pseudomallei B7210]
 gi|167895898|ref|ZP_02483300.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 7894]
 gi|167904283|ref|ZP_02491488.1| dihydrodipicolinate reductase [Burkholderia pseudomallei NCTC
           13177]
 gi|167912544|ref|ZP_02499635.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 112]
 gi|167920498|ref|ZP_02507589.1| dihydrodipicolinate reductase [Burkholderia pseudomallei BCC215]
 gi|166222621|sp|A3NZB9|DAPB_BURP0 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166222622|sp|A3NDK8|DAPB_BURP6 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|126227294|gb|ABN90834.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 1106a]
          Length = 265

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 159/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLAAPDATLAGALDRTGSPQLGQDAGAFLG-KQTGVALTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +V 
Sbjct: 60  IERVCAEADYLIDFTRPEGTLAHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGGKIALVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA    
Sbjct: 120 SANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RTLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L AA +      G + M+DVLG+
Sbjct: 238 AQGALRAARFLAGHQAGFFDMQDVLGL 264


>gi|167580570|ref|ZP_02373444.1| dihydrodipicolinate reductase [Burkholderia thailandensis TXDOH]
          Length = 265

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 161/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLG-KQTGVALTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +V 
Sbjct: 60  IERVCAEADYLIDFTRPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIALVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA    
Sbjct: 120 SANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L AA +   +  G + M+DVLG+
Sbjct: 238 AQGALRAARFLAGRDAGFFDMQDVLGL 264


>gi|264680775|ref|YP_003280685.1| dihydrodipicolinate reductase [Comamonas testosteroni CNB-2]
 gi|262211291|gb|ACY35389.1| dihydrodipicolinate reductase [Comamonas testosteroni CNB-2]
          Length = 277

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 156/269 (57%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P R++V G  GRMG  LI+ I N+    L + + R+ SP IG D   F+G  P G+K  
Sbjct: 10  TPQRVAVAGASGRMGHMLIEAILNSSDCVLAAALDRADSPAIGTDPSAFLG-KPSGLKIE 68

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            ++  A+   D +IDF+ P  T++ L ++A   +  +IGTTGFS ++   I+ FA+   I
Sbjct: 69  SDVRAALSKADCLIDFTRPEGTMEHLAVAADLGVGVVIGTTGFSDEQKTQIAEFAQKTSI 128

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L+E AA+ L     +D EI+E HH+ K+D+PSGTAL +GE IA  
Sbjct: 129 VFAPNMSVGVNVTFKLLEMAAKALQQGG-YDIEIVEAHHKHKVDAPSGTALKMGEVIAEA 187

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           +   L D  V  R      R   +IG A++R G IVG+H+V+ AG GE I ++H +  R 
Sbjct: 188 QGTKLADRAVYERFGHTGERKADTIGFATVRGGDIVGDHTVLFAGTGERIEIAHKSSSRA 247

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A GSL A  +   +  G Y M DVL +
Sbjct: 248 GYANGSLRAVAYLADKKTGQYDMYDVLNL 276


>gi|299065702|emb|CBJ36876.1| dihydrodipicolinate reductase(DHPR) [Ralstonia solanacearum CMR15]
          Length = 263

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 160/267 (59%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R+GS  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGVTLAAALDRAGSETVGQDAGARLG-KATGVIVTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+ P  TL  L I+ +  +  +IGTTGF+ ++      +     +V 
Sbjct: 60  LRAGLSQADVLIDFTRPEATLAHLEIARELGVGVVIGTTGFTAEQKASFKDYGATIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDVEIVEAHHKHKIDAPSGTALKMGEIVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L +  V  R  +   RT G+IG A++R G IVG+H+V+  GEGE I ++H +  R+ +
Sbjct: 178 TTLAERAVYAREGETGPRTNGTIGFATVRGGDIVGDHTVLFVGEGERIEITHRSNSRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA +   +  GL+ M DVLG+
Sbjct: 238 AEGAVRAACFLAGK-KGLFDMNDVLGL 263


>gi|296101204|ref|YP_003611350.1| hypothetical protein ECL_00838 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055663|gb|ADF60401.1| hypothetical protein ECL_00838 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 273

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 152/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALQMDGVALGAALEREGSSLLGADAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   +  
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTTGFDEAGKQAIQDASHE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIVEAHHRYKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V  R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYTREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLKGKENGLFDMRDVL 268


>gi|167837878|ref|ZP_02464761.1| dihydrodipicolinate reductase [Burkholderia thailandensis MSMB43]
          Length = 265

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 161/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLAAPDATLAGALDRTGSPQLGQDAGAFLG-KQTGVALTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +V 
Sbjct: 60  IERVCAEADCLIDFTRPEGTLAHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGERIALVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA    
Sbjct: 120 SANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDECAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L AA +   +  G + M+DVLG+
Sbjct: 238 AQGALRAARFLAGRETGFFDMQDVLGL 264


>gi|241205267|ref|YP_002976363.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859157|gb|ACS56824.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 256

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 154/271 (56%), Gaps = 21/271 (7%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           SP++I+V G  GRMG+A++  +  +P       I R GS                G    
Sbjct: 3   SPIKIAVAGANGRMGRAILPLLAADPDFAFVGGIGREGS---------------AGAGLI 47

Query: 63  DNLAMAIQSVDGIIDFSS--PALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
           D  + AI++ D I+DF++   A  L  L  SA    + +IG TGF   E E I+  AR  
Sbjct: 48  DR-SSAIKAADVILDFTTGRAAAELAGLCASAGGPAL-VIGATGFEPDELERIAEAARAI 105

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
           PI++S N S+G+N L  LV  AA  L PA  WD EILE HH RK+D+PSGTAL+LGEA A
Sbjct: 106 PILRSGNFSIGVNMLVGLVAQAARAL-PANGWDIEILEAHHNRKIDAPSGTALMLGEAAA 164

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V+L       R      R  G IG A LRAG +VGEHSV+ A   E +TLSHSA D
Sbjct: 165 EGRGVSLASVERRGRDGITGERPPGEIGFAVLRAGGLVGEHSVLFAAAEEVVTLSHSALD 224

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +FARG L AA W   + PG Y+MRDVLG+
Sbjct: 225 RGMFARGVLAAARWIAGRPPGQYAMRDVLGL 255


>gi|299529346|ref|ZP_07042784.1| dihydrodipicolinate reductase [Comamonas testosteroni S44]
 gi|298722595|gb|EFI63514.1| dihydrodipicolinate reductase [Comamonas testosteroni S44]
          Length = 277

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 156/269 (57%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P R++V G  GRMG  LI+ I N+    L + + R+ SP IG D   F+G  P G+K  
Sbjct: 10  TPQRVAVAGASGRMGHMLIEAILNSSDCVLAAALDRADSPAIGTDPSAFLG-KPSGLKIE 68

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            ++  A+   D +IDF+ P  T++ L ++A   +  +IGTTGFS ++   I+ FA+   I
Sbjct: 69  SDVRAALSKADCLIDFTRPEGTMEHLAVAADLGVGVVIGTTGFSDEQKTQIAEFAQKTSI 128

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L+E AA+ L     +D EI+E HH+ K+D+PSGTAL +GE IA  
Sbjct: 129 VFAPNMSVGVNVTFKLLEMAAKALQQGG-YDIEIVEAHHKHKVDAPSGTALKMGEVIAEA 187

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           +   L D  V  R      R   +IG A++R G IVG+H+V+ AG GE I ++H +  R 
Sbjct: 188 QGTRLADRAVYERFGHTGERKADTIGFATVRGGDIVGDHTVLFAGTGERIEIAHKSSSRA 247

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A GSL A  +   +  G Y M DVL +
Sbjct: 248 GYANGSLRAVAYLADKKTGQYDMYDVLNL 276


>gi|317046859|ref|YP_004114507.1| dihydrodipicolinate reductase [Pantoea sp. At-9b]
 gi|316948476|gb|ADU67951.1| dihydrodipicolinate reductase [Pantoea sp. At-9b]
          Length = 271

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 156/272 (57%), Gaps = 5/272 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +RI+++G  GRMG+ LI+       + L + + R+GS LIG D G   GI   G+  +
Sbjct: 2   SEIRIAIVGAPGRMGRNLIQAAQQAEGVVLGAALARAGSSLIGSDAGELAGIGKTGVIIT 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L   +   D +IDF+ P  TL+ L    QH+   +IGTTGF       I + A    I
Sbjct: 62  ADLQQVVNDFDVLIDFTRPEGTLEYLAFCRQHHKAMVIGTTGFDEAGKAAIRAAAEEIGI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           V ++N S+G+N +  L++ AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEAIA 
Sbjct: 122 VFAANFSVGVNLVLELLKQAAKVM---GDYADIEIVEAHHRHKVDAPSGTALAMGEAIAE 178

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
                L +H V  R      R   +IG A++RAG IVGEH+ + A  GE + ++H A  R
Sbjct: 179 AMDWKLDEHAVYAREGHTGERKAQTIGFATVRAGDIVGEHTAMFADIGERVEITHKASSR 238

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGIGL 273
             FA G++ AA W K +  GLY MRDVL + +
Sbjct: 239 MTFANGAVKAASWLKDKKSGLYDMRDVLDLSM 270


>gi|295098557|emb|CBK87647.1| dihydrodipicolinate reductase [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 273

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 107/270 (39%), Positives = 152/270 (56%), Gaps = 3/270 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALQMDGVALGAALEREGSSLLGADAGELAGAGQTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L    +  D  IDF+ P  TL  L    QH    +IGTTGF     + I   +  
Sbjct: 61  TVQSSLEAVKEDFDVFIDFTRPEGTLAHLAFCRQHGKGMVIGTTGFDEVGKQAIQDASTE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  L+E AA+ +   +  D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM--GEYTDIEIVEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A 
Sbjct: 179 ACAMDKDLKDIAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
            R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 239 SRMTFANGAVRSALWLKGKRNGLFDMRDVL 268


>gi|33598013|ref|NP_885656.1| dihydrodipicolinate reductase [Bordetella parapertussis 12822]
 gi|33602918|ref|NP_890478.1| dihydrodipicolinate reductase [Bordetella bronchiseptica RB50]
 gi|39931035|sp|Q7W510|DAPB_BORPA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|39931042|sp|Q7WGH5|DAPB_BORBR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|33568549|emb|CAE34307.1| dihydrodipicolinate reductase [Bordetella bronchiseptica RB50]
 gi|33574442|emb|CAE38780.1| dihydrodipicolinate reductase [Bordetella parapertussis]
          Length = 269

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 109/269 (40%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P RI++ G  GRMGQ LI+ + +   + L   + R+GSP IGQD G  +G  P G+  +
Sbjct: 5   TPQRIAIAGASGRMGQMLIEAVLDTEGVELAVALDRAGSPSIGQDAGAALG-RPCGVTIT 63

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D L  A+   D +IDF+ P  TLQ L    +H++  +IGTTGF       I   A+   I
Sbjct: 64  DQLD-ALAQADCLIDFTRPEGTLQHLQACLRHDVKMVIGTTGFDSSGRAEIEVAAQKIAI 122

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L++ AA  L     +D EI E HHR K+D+PSGTAL++GE +A+ 
Sbjct: 123 VFAPNMSVGVNATLKLLDMAARIL--NSGYDVEIFEAHHRNKVDAPSGTALIMGETVASA 180

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
             V L D     RH     R  G+IG + +R G IVG+H+V   G GE I +SH +  R 
Sbjct: 181 WDVALPDVATWTRHGDTGVRKPGTIGFSVVRGGDIVGDHTVFFCGTGERIEISHRSSSRA 240

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+G++ AA +   Q  GLY M+ VLG+
Sbjct: 241 TYAQGAVRAARFLARQDNGLYDMQAVLGL 269


>gi|114331914|ref|YP_748136.1| dihydrodipicolinate reductase [Nitrosomonas eutropha C91]
 gi|122313361|sp|Q0AER1|DAPB_NITEC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|114308928|gb|ABI60171.1| dihydrodipicolinate reductase [Nitrosomonas eutropha C91]
          Length = 268

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 162/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           + I+V G  GRMG+ +++ I +   + L + + +  SP + QD G   G +P G+  + +
Sbjct: 4   LNIAVAGSTGRMGRTIMETIADAQDLRLSAALEQPDSPYLSQDAGGLTG-TPCGVIINSD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
            A A+   D +IDF+ PA TL  L +  Q  I  +IGTTGFS +E E+I   A++  IV 
Sbjct: 63  YASALTGSDVLIDFTRPAGTLTHLAVCRQSGIHMVIGTTGFSAEEKEIIHDAAKDIAIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N L  L+E AA+ L PA  +D EI+E HHR K+D+PSGTAL +GE IA  + 
Sbjct: 123 APNMSVGVNILFRLLEVAAKAL-PAG-YDVEIIEAHHRHKVDAPSGTALRMGEVIAQTQG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL    +  R      R   +IG +++R G IVG+H+ + AG GE + ++H A  R+ F
Sbjct: 181 KNLEKVAIYGREGHTGERAADTIGFSTIRGGDIVGDHTALFAGIGERLEITHKASSRKTF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AA +  ++  GL+ M+DVLG+
Sbjct: 241 ATGALHAARFLATKKSGLFDMQDVLGL 267


>gi|318607181|emb|CBY28679.1| dihydrodipicolinate reductase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 273

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 111/273 (40%), Positives = 159/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + R GS L+G D G   G   + I
Sbjct: 1   MTNSTIRIAVVGAGGRMGRQLIQAITQTKGVVLGAAVERPGSSLVGSDAGELAGAGLLNI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +D+L   I   D +IDF+ P  TL+ L I   H    IIGTTGF       I++ A +
Sbjct: 61  TVNDDLTKVIDDFDVLIDFTRPEGTLEHLAICRTHRKAMIIGTTGFDDAGKAAINAAASD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E  A+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVVLKLLEKTAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAESLGRSLKDCAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W  +   GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWLSNHDNGLFDMRDVLSL 270


>gi|33593492|ref|NP_881136.1| dihydrodipicolinate reductase [Bordetella pertussis Tohama I]
 gi|7531089|sp|Q9X6Y9|DAPB_BORPE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|4678391|emb|CAB41012.1| dihydrodipicolinate reductase [Bordetella pertussis]
 gi|33572848|emb|CAE42781.1| dihydrodipicolinate reductase [Bordetella pertussis Tohama I]
 gi|332382900|gb|AEE67747.1| dihydrodipicolinate reductase [Bordetella pertussis CS]
          Length = 269

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 109/269 (40%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P RI++ G  GRMGQ LI+ + +   + L   + R+GSP IGQD G  +G  P G+  +
Sbjct: 5   TPQRIAIAGASGRMGQMLIEAVLDTEGVELAVALDRAGSPSIGQDAGAALG-RPCGVTIT 63

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D L  A+   D +IDF+ P  TLQ L    +H++  +IGTTGF       I   A+   I
Sbjct: 64  DQLD-ALAQADCLIDFTRPEGTLQHLQACLRHDVKMVIGTTGFDSSGRAEIKVAAQKIAI 122

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L++ AA  L     +D EI E HHR K+D+PSGTAL++GE +A+ 
Sbjct: 123 VFAPNMSVGVNATLKLLDMAARIL--NSGYDVEIFEAHHRNKVDAPSGTALIMGETVASA 180

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
             V L D     RH     R  G+IG + +R G IVG+H+V   G GE I +SH +  R 
Sbjct: 181 WDVALPDVATWTRHGDTGVRKPGTIGFSVVRGGDIVGDHTVFFCGTGERIEISHRSSSRA 240

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+G++ AA +   Q  GLY M+ VLG+
Sbjct: 241 TYAQGAVRAARFLARQDNGLYDMQAVLGL 269


>gi|114769582|ref|ZP_01447192.1| dihydrodipicolinate reductase [alpha proteobacterium HTCC2255]
 gi|114549287|gb|EAU52169.1| dihydrodipicolinate reductase [alpha proteobacterium HTCC2255]
 gi|297184254|gb|ADI20372.1| dihydrodipicolinate reductase [uncultured alpha proteobacterium
           EB080_L27A02]
          Length = 269

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 165/266 (62%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I+++G  GRMGQ LI+ +  +  + L  +  R G   +GQD+G  +G + +GI  S+N 
Sbjct: 6   KIAIVGASGRMGQMLIQSVLASNKVKLAGVTEREGHDWLGQDLGVCMGRAEIGINVSNNP 65

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
               ++ D +IDF+SP  T++   ++ +  IVH+IGTTG      + + + +++  I+++
Sbjct: 66  MEVFKNADAVIDFTSPKATIEHAKLAVKAGIVHVIGTTGMDSSHLDKLKNLSKDIVIIRA 125

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMSLG+N L  L +  +  L   +D+D EI+E HH+ K+D+PSGTAL+LG+A A GR V
Sbjct: 126 GNMSLGLNLLTLLTKKISAAL--DEDFDIEIVESHHKHKVDAPSGTALMLGQAAAEGRGV 183

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L++     R     AR  G IG  ++R G +VGEH V+ A +GE I L H A DR+IF 
Sbjct: 184 DLSNVEDRGRDGITGARKRGDIGFHAIRGGDVVGEHDVIFAADGERIVLRHLATDRQIFV 243

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG+L AA+W + +  G Y M DVLG+
Sbjct: 244 RGALRAAIWGQGKDAGEYDMIDVLGL 269


>gi|283835093|ref|ZP_06354834.1| dihydrodipicolinate reductase [Citrobacter youngae ATCC 29220]
 gi|291069388|gb|EFE07497.1| dihydrodipicolinate reductase [Citrobacter youngae ATCC 29220]
          Length = 273

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 155/271 (57%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH++ +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G+    +
Sbjct: 1   MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLLGGDAGELAGVGKANV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A+ 
Sbjct: 61  IVQSSLEAVKDDFDVFIDFTRPEGTLAHLAFCRQHGKGMVIGTTGFDDAGKQAIRDAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALDKDLQDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +A+W KS+  GL+ M+DVL
Sbjct: 238 SSRMTFANGAVRSAIWLKSKSNGLFDMKDVL 268


>gi|257464632|ref|ZP_05629003.1| dihydrodipicolinate reductase [Actinobacillus minor 202]
 gi|257450292|gb|EEV24335.1| dihydrodipicolinate reductase [Actinobacillus minor 202]
          Length = 270

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 149/268 (55%), Gaps = 3/268 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I+++G GGRMG+ LI+ + N   + L +   R GS LIG D G   GI  +G+  ++
Sbjct: 2   TLKIAIVGAGGRMGRNLIQAVQNMDGVELGAAFERQGSSLIGSDAGEVAGIGHLGVNIAE 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           NLA      D +IDF+ P  TL  L     H    IIGTTGF     E I   +    IV
Sbjct: 62  NLAEQADHFDVLIDFTRPEGTLAHLQFCVAHQKKMIIGTTGFDDAGKEAIKEASEKIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 180 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   +  GL+ M DVL +
Sbjct: 240 FANGAVRAAKWLADKNNGLFDMTDVLNL 267


>gi|114571536|ref|YP_758216.1| dihydrodipicolinate reductase [Maricaulis maris MCS10]
 gi|114341998|gb|ABI67278.1| dihydrodipicolinate reductase [Maricaulis maris MCS10]
          Length = 274

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 106/272 (38%), Positives = 160/272 (58%), Gaps = 8/272 (2%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P+R++VLG  GR+G A+ + + ++P   +   +VR+ SP+ G+D+G ++G  P+  +  
Sbjct: 3   APIRVAVLGPTGRLGSAICRALLDSPDFRIAGAVVRAESPVSGEDIGTWLGRDPIDCRAE 62

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLN-ISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
            +L  AI++ D ++D S P +T+ +   +++      I G TGF+ ++++ +++ A   P
Sbjct: 63  TSLEHAIETADIVLDASLPGMTVAAAERLASLGGPALITGVTGFNREQSDRLTACADRLP 122

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           ++ + N SLG+     LV  AA   LPA DWD E+ E HHRRK D+PSGTAL+L    A 
Sbjct: 123 VLLAGNFSLGVAVTEALVREAAR--LPAADWDIEVHETHHRRKADAPSGTALMLARTAAK 180

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
            R  +L      +R      R  GSIG A  R GS+VGEHSV    E E IT+SH A DR
Sbjct: 181 SRGESLESLATWSREGVTGPRKTGSIGFAVSRGGSVVGEHSVRFLAELEEITISHRALDR 240

Query: 242 RIFARGSLTAALW----AKSQIPGLYSMRDVL 269
            IFARG+L AA W       +  G YSM+DV+
Sbjct: 241 SIFARGALAAARWMINGGAGRAAGEYSMQDVV 272


>gi|307730982|ref|YP_003908206.1| dihydrodipicolinate reductase [Burkholderia sp. CCGE1003]
 gi|307585517|gb|ADN58915.1| dihydrodipicolinate reductase [Burkholderia sp. CCGE1003]
          Length = 265

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 160/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+   TL   + R+GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDSDATLSGALDRAGSPQLGQDAGAFLG-KQTGVVLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  T+  L  + +HN+  +IGTTGF   +   + + A    I+ 
Sbjct: 60  IERVFAESDYLIDFTRPEGTMAHLEAAQRHNVKMVIGTTGFDNAQKAQLRAAADKIAIMF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SNMS+G+N    L+E AA++   A  +D EI+E HHR K+D+PSGTAL +GE IAN   
Sbjct: 120 ASNMSVGVNVTLKLLEFAAKHF--ATGYDIEIIEAHHRHKVDAPSGTALTMGEVIANALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  V +R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RNLDDCAVYSREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  + +    G + M+DVLG+
Sbjct: 238 AQGALRAVRFLEGHPTGFFDMQDVLGL 264


>gi|327398436|ref|YP_004339305.1| dihydrodipicolinate reductase [Hippea maritima DSM 10411]
 gi|327181065|gb|AEA33246.1| Dihydrodipicolinate reductase [Hippea maritima DSM 10411]
          Length = 267

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 111/267 (41%), Positives = 151/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R  V G  G+MG+ +   +  +  +TL   +   GS  IGQD G        GI   D+
Sbjct: 2   IRTIVCGASGKMGRRICALVGEDKDLTLVGAVEAKGSSAIGQDAGVLATGVANGIAVKDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  I+  + +IDF++P  TL  + I++ H    +IGTTG    + + I   +   PIV 
Sbjct: 62  LAKVIEEGEVVIDFTAPDATLHHVRIASDHKKPIVIGTTGLHKDQIKEIEKLSVIIPIVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMSLG+N L  LVE  A  L    D+D EI+EMHHR K D+PSGTAL L E  A G  
Sbjct: 122 APNMSLGVNILFKLVEEVARTL--KDDYDIEIVEMHHRFKADAPSGTALKLAEFAAKGIG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  +  R      R    IGI SLR G +VG+H+V+ AG GE + L+H A  R  F
Sbjct: 180 EDLENIAIYGRKGLVGQRNSKEIGIMSLRGGDVVGDHTVIFAGLGERVELTHKASSRDTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG+L AA W   ++PGLYSM+DVLG+
Sbjct: 240 ARGALRAAKWVVDKVPGLYSMQDVLGL 266


>gi|257137922|ref|ZP_05586184.1| dihydrodipicolinate reductase [Burkholderia thailandensis E264]
          Length = 265

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 161/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLG-KQTGVALTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +V 
Sbjct: 60  IERVCAEADYLIDFTLPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIALVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA    
Sbjct: 120 SANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L AA +   +  G + M+DVLG+
Sbjct: 238 AQGALRAARFLAGRDAGFFDMQDVLGL 264


>gi|283783816|ref|YP_003363681.1| dihydrodipicolinate reductase [Citrobacter rodentium ICC168]
 gi|282947270|emb|CBG86815.1| dihydrodipicolinate reductase [Citrobacter rodentium ICC168]
          Length = 273

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/271 (38%), Positives = 154/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+ +     + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQVRVAIAGAGGRMGRQLIQAVLQMEGVALGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    +H    +IGTTGF     + I   +R 
Sbjct: 61  TVQSSLEAVKDDFDVFIDFTRPEGTLNHLAFCREHGKAMVIGTTGFDEAGKQAIRDASRQ 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L    V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKACAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW  ++  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSAKQNGLFDMRDVL 268


>gi|88812332|ref|ZP_01127582.1| dihydrodipicolinate reductase [Nitrococcus mobilis Nb-231]
 gi|88790339|gb|EAR21456.1| dihydrodipicolinate reductase [Nitrococcus mobilis Nb-231]
          Length = 268

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 151/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I + G  GRMG+ L+  +  NP   L + I   GS  IG D G+  GI  +G+   D 
Sbjct: 2   IKIGICGTAGRMGRTLVAAVVQNPHTRLAAAIEHQGSRWIGADAGDLAGIGTLGLSLVDE 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
            A AI S D ++DF+ P  T+ +L +        +IGTTG    +   +S  A   PIV 
Sbjct: 62  PAAAIDSSDVLVDFTVPEATMANLALCRAAGKPIVIGTTGLDQAQRRELSRTAEVLPIVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S G+N    L+E AA  L   +D+D E++E HHR K+D+PSGTAL +GE +A+   
Sbjct: 122 APNFSAGVNLTFKLIELAARAL--GEDFDIEVIEAHHRHKIDAPSGTALRMGEILASALD 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +     V +R  +   R   +IG AS+R G IVGEH+V+ AG GE + ++H A  R  F
Sbjct: 180 RDFGTSAVYSRQGRTGERDRKTIGFASVRGGDIVGEHTVLYAGLGERLEITHRASSRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W   Q  GLY M+DVLG+
Sbjct: 240 ANGAVRAAVWLAGQTAGLYDMQDVLGL 266


>gi|95928625|ref|ZP_01311372.1| Dihydrodipicolinate reductase [Desulfuromonas acetoxidans DSM 684]
 gi|95135415|gb|EAT17067.1| Dihydrodipicolinate reductase [Desulfuromonas acetoxidans DSM 684]
          Length = 281

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/271 (38%), Positives = 163/271 (60%), Gaps = 11/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMG  LIK + +   ITL + I R G P++GQD G   G   + +  SD 
Sbjct: 16  LKIAVTGAAGRMGGHLIKAVTDAEGITLAAAIERPGHPMVGQDAGILAGCGALNVLISDQ 75

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  ++++VD +IDF+ P +TL +  I A+     +IG+TGF+ ++ + ++    N  ++ 
Sbjct: 76  LEASLKAVDVLIDFTFPDVTLANAEICAKVKTNMVIGSTGFTPEQRQQLADTTGNIAVML 135

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    L++ AA  L     +D E++E+HH +K DSPSGTA+ +GE +A+  G
Sbjct: 136 APNMSVGVNACFKLLKEAANIL--GDGFDVEVVELHHNKKKDSPSGTAVRMGEVVADALG 193

Query: 183 RKVNLTDHMVLNRHIQ-QCA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT+  IG+ ++R G IVGEH+V   G GE I ++H A  
Sbjct: 194 RDYN----KVANYHREGMCGERTKEEIGMQTVRGGDIVGEHTVYFIGMGERIEITHRAMS 249

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RG+  A  W K + PG+Y M+DVL +
Sbjct: 250 REMFSRGAARACQWIKDKAPGMYDMQDVLDL 280


>gi|312795136|ref|YP_004028058.1| dihydrodipicolinate reductase [Burkholderia rhizoxinica HKI 454]
 gi|312166911|emb|CBW73914.1| Dihydrodipicolinate reductase (EC 1.3.1.26) [Burkholderia
           rhizoxinica HKI 454]
          Length = 266

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 160/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ L++ + N P +TL   + R+G+  +GQD G F G    GI  +D+
Sbjct: 2   MKIAIAGASGRMGQMLVETVLNTPEVTLSGALDRAGAAALGQDAGAFAG-RQTGIAITDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL+ L  + +H    +IGTTGF+  +   +++ A+   IV 
Sbjct: 61  VERVLAHADVLIDFTRPEGTLEHLKAARRHGTRMVIGTTGFAESQKAELAAAAQTLGIVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L++ AA +   A  +D EI+E HHR K+D+PSGTAL +GE IA    
Sbjct: 121 APNMSVGVNVTLKLLQVAAAHF--ATGYDIEIIEAHHRHKVDAPSGTALQMGEVIATALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H + +R  +
Sbjct: 179 RDLASCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVMFAGTGERIEITHKSANRLAY 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA +   +  GLY M DVLG+
Sbjct: 239 AQGAVRAARFLAGRPAGLYDMWDVLGL 265


>gi|124516712|gb|EAY58220.1| Dihydrodipicolinate reductase [Leptospirillum rubarum]
          Length = 265

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/268 (40%), Positives = 162/268 (60%), Gaps = 11/268 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++++G  GRMG+A+ + +  NP  TL + IV +  P+ G+ V    G+      ++ +
Sbjct: 2   LRVALVGAAGRMGKAIQEVLEKNPGTTLSAAIVEANDPMNGKPVLFGDGV------YTSS 55

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D  IDFS  +  L+++   ++     +IGTTGFS KE E I       P++ 
Sbjct: 56  LEDALGKSDVGIDFSEVSSALETVEAFSRSGRPLVIGTTGFSAKEKERIYQAGERIPLIL 115

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLGI+ L +LV+ AAE L     +D EI+E HHR K D+PSGTAL LGE++A+ R 
Sbjct: 116 SPNMSLGIHLLSYLVKIAAEKL---PSYDAEIVETHHRMKKDAPSGTALFLGESLASARG 172

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D    +R      R + SIGI +LR G +VG+H+V   GEGE + L+H A  R  F
Sbjct: 173 KRLGDVGTYHREGMTGVRPQDSIGIMALRGGDVVGDHTVFFLGEGERLELTHRATSRETF 232

Query: 245 ARGSLTAALW-AKSQIPGLYSMRDVLGI 271
           ARG++ AA++ A+ + PG+Y+M DVLG+
Sbjct: 233 ARGAVEAAVFLARKKTPGVYTMTDVLGL 260


>gi|171322984|ref|ZP_02911655.1| Dihydrodipicolinate reductase [Burkholderia ambifaria MEX-5]
 gi|171091637|gb|EDT37213.1| Dihydrodipicolinate reductase [Burkholderia ambifaria MEX-5]
          Length = 265

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + ++    L   + R+ SP +GQD G F+G    G+K +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLDDSDAQLVGALDRADSPFLGQDAGAFLG-KETGVKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  T+  +  + +H++  +IGTTGF+V++   + + A    IV 
Sbjct: 60  LDAVFAQADYLIDFTRPEGTIAHVAAALRHDVKLVIGTTGFTVEQKAELQAAAARIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|7531084|sp|O69783|DAPB2_RHIME RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
          Length = 242

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 149/244 (61%), Gaps = 4/244 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S MR+ V+G  GRMG+ LIK I  NP   L   + R GS  +GQD G   G++  G+  +
Sbjct: 2   SQMRLVVVGAAGRMGRTLIKAIAENPGCMLSGAVERPGSAAVGQDAGFVAGMASCGVLVT 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D    A    DG++DF++P  T +  +++AQ  IVH++GTTG        +   AR  P+
Sbjct: 62  DEPGSAFAEADGVLDFTTPDATAEYSSLAAQVGIVHVVGTTGMEPVHFSKLVRAARTIPV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V+S NMSLG+N L  LV+  A  L   K+WD E+LEMHHR K+D+PSG ALLLGEA A+G
Sbjct: 122 VQSGNMSLGVNILAALVQKVAAIL--DKEWDIEVLEMHHRMKVDAPSGAALLLGEAAASG 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R+  L+DH V  R      RT G+IG A   AG +VG+H VV AG G  I LSH A DR 
Sbjct: 180 RQTILSDHYVAGRDGYTGCRTVGTIGFAPC-AGXVVGDHKVVFAGAGXRIELSHIAEDRS 238

Query: 243 IFAR 246
           +FA+
Sbjct: 239 LFAQ 242


>gi|330722199|gb|EGH00092.1| Dihydrodipicolinate reductase [gamma proteobacterium IMCC2047]
          Length = 267

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 152/266 (57%), Gaps = 3/266 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V G  GRMG+AL++ +       L   +VR  S L+G D G   G    G+K   +L
Sbjct: 3   RIAVTGVAGRMGKALVEAVMQAEGAELTVAVVRPDSSLVGVDSGELAGAGSNGVKVVGDL 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           +  +   D +IDF++PA TL +  + A+     ++GTTGF+  E   + + A    +  +
Sbjct: 63  SEVVDDFDVLIDFTTPAATLSNAALCAKAGKQLVVGTTGFTDDEKAQMLATADQTALCVA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           SN S G+N    L++ AA  L    D D E+ E HHR K+D+PSGTAL +GE +AN    
Sbjct: 123 SNFSTGVNLCFKLLDIAARVL--GDDADIEVYEAHHRHKVDAPSGTALSMGEVVANALDR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L+   V  R  Q  AR   +IG A++RAG IVG+H+V+ A +GE + ++H A  R  FA
Sbjct: 181 DLSKCAVYGREGQTGARDRETIGFATVRAGDIVGDHTVIFAADGERVEITHKASSRMSFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG++ AA W   +  GL+ M+DVL +
Sbjct: 241 RGAVRAAQWLSKKSSGLFDMQDVLNL 266


>gi|297183948|gb|ADI20069.1| hypothetical protein [uncultured alpha proteobacterium
           EB080_L11F12]
          Length = 269

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 165/266 (62%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I+++G  GRMGQ LI+ +  +  + L  +  R G   +GQD+G  +G + +GI  S+N 
Sbjct: 6   KIAIVGASGRMGQMLIQSVLASNKVKLAGVTEREGHDWLGQDLGVCMGRAEIGINVSNNP 65

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
               ++ D +IDF++P  T++   ++ +  IVH+IGTTG      + + + +++  I+++
Sbjct: 66  MEVFKNADAVIDFTTPKATIEHAKLAVKAGIVHVIGTTGMDSSHLDKLKNLSKDIVIIRA 125

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMSLG+N L  L +  +  L   +D+D EI+E HH+ K+D+PSGTAL+LG+A A GR V
Sbjct: 126 GNMSLGLNLLTLLTKKISAAL--DEDFDIEIVESHHKHKVDAPSGTALMLGQAAAEGRGV 183

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L++     R     AR  G IG  ++R G +VGEH V+ A +GE I L H A DR+IF 
Sbjct: 184 DLSNVEDRGRDGITGARKRGDIGFHAIRGGDVVGEHDVIFAADGERIVLRHLATDRQIFV 243

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG+L AA+W + +  G Y M DVLG+
Sbjct: 244 RGALRAAIWGQGKDAGEYDMIDVLGL 269


>gi|240949232|ref|ZP_04753576.1| dihydrodipicolinate reductase [Actinobacillus minor NM305]
 gi|240296348|gb|EER46992.1| dihydrodipicolinate reductase [Actinobacillus minor NM305]
          Length = 270

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/268 (39%), Positives = 150/268 (55%), Gaps = 3/268 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I+++G GGRMG+ LI+ + N   + L +   R GS LIG D G   GI  +G+K ++
Sbjct: 2   TLKIAIVGAGGRMGRNLIQAVQNMDGVELGAAFERQGSSLIGSDAGEVAGIGHLGVKIAE 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +LA      D +IDF+ P  TL  L     H    IIGTTGF     + I   +    IV
Sbjct: 62  SLAEQADCFDVLIDFTRPEGTLAHLQFCVAHQKKMIIGTTGFDDAGKQAIKEASEKIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 180 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA W   +  GL+ M DVL +
Sbjct: 240 FANGAVRAAKWLADKNNGLFDMTDVLNL 267


>gi|78485217|ref|YP_391142.1| dihydrodipicolinate reductase [Thiomicrospira crunogena XCL-2]
 gi|78363503|gb|ABB41468.1| dihydrodipicolinate reductase [Thiomicrospira crunogena XCL-2]
          Length = 266

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 157/267 (58%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MR++V+G  GRMG+ LI  ++    ++L + I R GS L+G D G   G+  +G+K  D 
Sbjct: 1   MRVAVIGASGRMGKNLIDAVNQTEGLSLSAAIERPGSSLVGADAGELAGVGSLGVKIVDQ 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           + +     D +IDF++P  TL ++ +   H+   +IGTTGF     +VI   A+   IV 
Sbjct: 61  IELVADDFDVLIDFTTPDTTLHNIKVCLAHDKKIVIGTTGFDEAGLKVIKEAAQRIAIVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++ AAE L   + +D E++E HHR K+D+PSGTAL +GE +A    
Sbjct: 121 AANFSVGVNLALKLLKQAAEVL--NEGYDIEVIEGHHRHKVDAPSGTALRMGEVVAETLG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      R   +IG A++RAG IVG+H+V+ A EGE + ++H A  R  F
Sbjct: 179 RDLKECAVYGREGITGERDPNTIGFATVRAGDIVGDHTVLFATEGERVEITHKASSRMTF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+  +  W   +  GL+ M+DVL +
Sbjct: 239 AKGAARSCNWLSDKQTGLFDMQDVLNL 265


>gi|289209005|ref|YP_003461071.1| dihydrodipicolinate reductase [Thioalkalivibrio sp. K90mix]
 gi|288944636|gb|ADC72335.1| dihydrodipicolinate reductase [Thioalkalivibrio sp. K90mix]
          Length = 264

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/267 (41%), Positives = 155/267 (58%), Gaps = 8/267 (2%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++V G  GRMGQ L++ + ++P  TL +   R GS  +G  VG+   ++P  ++  ++
Sbjct: 2   IRVAVAGAAGRMGQNLVQAVEDHPEGTLGAASERPGSERLGTPVGS---VAP--VQLVED 56

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D +IDF+SPA T+Q L +   H    +IGTTG    + + +   A    IV 
Sbjct: 57  LASVADDFDVLIDFTSPAATMQHLELCRAHGKALVIGTTGLDAAQEQRLREAAGAMRIVY 116

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    LVE AA  L      D EILE HHR K+D+PSGTAL LG  +A    
Sbjct: 117 APNMSVGVNLTFKLVELAARAL--GDSVDVEILEAHHRHKVDAPSGTALKLGRVVAEVLG 174

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R  Q  AR   +IG A++RAG IVGEH+ + AGEGE I ++H A  R IF
Sbjct: 175 RDLEHDAVYGREGQTGARDRRTIGFATVRAGDIVGEHTALFAGEGERIEITHKASSRGIF 234

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W      GLY M+DVLG+
Sbjct: 235 AAGAVRAAVWLAGAEHGLYDMQDVLGL 261


>gi|260773486|ref|ZP_05882402.1| dihydrodipicolinate reductase [Vibrio metschnikovii CIP 69.14]
 gi|260612625|gb|EEX37828.1| dihydrodipicolinate reductase [Vibrio metschnikovii CIP 69.14]
          Length = 274

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 158/270 (58%), Gaps = 3/270 (1%)

Query: 3   QSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
           ++ +RI++ G  GRMG+ L+K  + NP+  + +   R  S L+G D+G   G     +  
Sbjct: 4   EAMIRIAIAGAAGRMGRNLVKASYYNPNTIVGAGSERPESSLVGVDIGELCGEGRFDVAL 63

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
            DNL  A+   D IIDF++P+ TL ++ +  +H+   +IGTTGF   +   I   A+   
Sbjct: 64  VDNLEQAVNDFDVIIDFTAPSSTLANIELCEKHHKKLVIGTTGFDESQLAQIKLAAQQVS 123

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           IV + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA+
Sbjct: 124 IVMAPNYSVGVNLVFKLLEKAAQVM--GDYCDIEIIEAHHRYKVDAPSGTAIGMGEAIAH 181

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
               NL+D  V  R      R    IG A++RAG IVGEH+ + A  GE + ++H A DR
Sbjct: 182 AMGNNLSDVAVYAREGITGERARHEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDR 241

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             FA G++ AA+W   +  GLYSM DVL +
Sbjct: 242 MTFANGAVKAAIWLADKPAGLYSMTDVLNL 271


>gi|238786674|ref|ZP_04630475.1| Dihydrodipicolinate reductase [Yersinia frederiksenii ATCC 33641]
 gi|238725042|gb|EEQ16681.1| Dihydrodipicolinate reductase [Yersinia frederiksenii ATCC 33641]
          Length = 273

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/273 (40%), Positives = 162/273 (59%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V+G GGRMG+ LI+ I     + L + + R+GS L+G D G   G   + I
Sbjct: 1   MTDSTIRIAVVGAGGRMGRQLIQAITQTEGVVLGAAVERAGSTLVGSDAGELAGTGLLNI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           + +D+L+      D +IDF+ P  TL+ L I  Q     +IGTTGF       IS+ A +
Sbjct: 61  QVNDDLSKVTDHFDVLIDFTRPEGTLEHLAICRQQGKAMVIGTTGFDDAGKAAISAAASD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 ISIVFAANFSVGVNVVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADSLGRSLKDCAVYSREGHTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHIA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W      GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAIWVSKHDNGLFDMRDVLSL 270


>gi|85058396|ref|YP_454098.1| dihydrodipicolinate reductase [Sodalis glossinidius str.
           'morsitans']
 gi|123520105|sp|Q2NVY2|DAPB_SODGM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|84778916|dbj|BAE73693.1| dihydrodipicolinate reductase [Sodalis glossinidius str.
           'morsitans']
          Length = 273

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 159/276 (57%), Gaps = 5/276 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +RI+V G GGRMG+ LI+ +  +   TL + + R+ S L G D G   GI  +G+
Sbjct: 1   MSNTSIRIAVAGAGGRMGRQLIQAVAQSEQATLGAALTRTDSALCGVDAGELAGIGALGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             S  LA      D +IDF+ P  ++  L    +H+   +IGTTGFS  + E I + A+ 
Sbjct: 61  AISGELAAVKDDFDILIDFTRPDASMAYLAFCRRHHKGIVIGTTGFSDAQKEAIRAEAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             +V ++N S+G+N +  L+E AA+ +   ++ D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 TGVVFAANFSVGVNLMLKLLEKAAQVM--GEEADIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L    V +R      R   SIG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 AGALGRDLARCAVYSREGHTGERKAKSIGFATVRAGDIVGEHTAMFAEIGERLEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDK 275
            R  FA G++ AA+W   Q  G + M +VL   LDK
Sbjct: 239 SRMTFASGAVRAAVWLSGQKRGFFDMVNVL--NLDK 272


>gi|167586112|ref|ZP_02378500.1| Dihydrodipicolinate reductase [Burkholderia ubonensis Bu]
          Length = 265

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 165/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+GSP +GQD G F+G    GI+ +D+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDSDAQLVGALDRAGSPHLGQDAGAFLG-RETGIRLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + +    IV 
Sbjct: 60  IDAVFAQADYLIDFTRPEGTIAHVEAALRHDVKLVIGTTGFTDEQKATLRAASDRIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 SANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GLY M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLYEMQDVLGL 264


>gi|226329200|ref|ZP_03804718.1| hypothetical protein PROPEN_03103 [Proteus penneri ATCC 35198]
 gi|225202386|gb|EEG84740.1| hypothetical protein PROPEN_03103 [Proteus penneri ATCC 35198]
          Length = 273

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 155/272 (56%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M    +R++V+G GGRMG+ LI+ I       L +   R+ S LIG D G   GI  +G+
Sbjct: 1   MSAKELRLAVVGAGGRMGRQLIQAISQQEGTVLGAAFERTNSSLIGSDAGELAGIGHIGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +DNL     + D +IDF+ P  TL  +    +     IIGTTGF  +  + I + A+ 
Sbjct: 61  TVTDNLLAQANAFDVLIDFTRPEGTLSHIEFCVEQQKGMIIGTTGFDDEGKKAIENAAKI 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            PIV ++N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +G +I
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM--GSYSDIEIVEAHHRHKVDAPSGTALAMGGSI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L +  V  R      R   SIG A++RAG IVGEH+ + A  GE + +SH A 
Sbjct: 179 AEALGRDLKECAVYERVGHTGERDPQSIGFATIRAGDIVGEHTAIFADIGERVEISHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G++ AA+W   +  GLY+M+DVL +
Sbjct: 239 SRMTFANGAVRAAIWLSCKKSGLYNMKDVLSL 270


>gi|78221436|ref|YP_383183.1| dihydrodipicolinate reductase [Geobacter metallireducens GS-15]
 gi|90101242|sp|Q39Z66|DAPB_GEOMG RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|78192691|gb|ABB30458.1| dihydrodipicolinate reductase [Geobacter metallireducens GS-15]
          Length = 266

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 160/271 (59%), Gaps = 12/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMGQ +I         T+   + R G  L+GQD G   G   +G+  SD+
Sbjct: 2   VKIAVCGAAGRMGQRIIVA-AKEAGCTVSGALERPGHELVGQDAGLIAGCGALGVAISDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF++P ++L++L   A      +IG+TGF+ +E  + +  A++ P V 
Sbjct: 61  LNAVVDGCDVLIDFTTPKVSLKNLEACALKKKAIVIGSTGFTPEERALAAELAKDIPAVL 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    +++  A+ L    D+D EI+E+HH +K D+PSGTA+ +GE +A   G
Sbjct: 121 APNMSVGVNVCFKILKDVAKTL--GDDFDVEIVELHHNKKKDAPSGTAVRMGEVVAEALG 178

Query: 183 RKVNLTDHMVLNRHIQQ-CA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT+  IG+ ++R G IVGEH+V   G GE I +SH A  
Sbjct: 179 RDYN----KVANYHREGICGERTKEEIGMQTVRGGDIVGEHTVYFIGMGERIEISHRAMT 234

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RGS+ AA W   + PGLY M+DVLG+
Sbjct: 235 RDMFSRGSVRAAQWVVGKAPGLYDMQDVLGL 265


>gi|53725686|ref|YP_104003.1| dihydrodipicolinate reductase [Burkholderia mallei ATCC 23344]
 gi|121598952|ref|YP_991723.1| dihydrodipicolinate reductase [Burkholderia mallei SAVP1]
 gi|124384862|ref|YP_001027216.1| dihydrodipicolinate reductase [Burkholderia mallei NCTC 10229]
 gi|126448602|ref|YP_001082168.1| dihydrodipicolinate reductase [Burkholderia mallei NCTC 10247]
 gi|238561236|ref|ZP_00442287.2| dihydrodipicolinate reductase [Burkholderia mallei GB8 horse 4]
 gi|251766605|ref|ZP_02264393.2| dihydrodipicolinate reductase [Burkholderia mallei PRL-20]
 gi|254178864|ref|ZP_04885518.1| dihydrodipicolinate reductase [Burkholderia mallei ATCC 10399]
 gi|254202722|ref|ZP_04909085.1| dihydrodipicolinate reductase [Burkholderia mallei FMH]
 gi|254208063|ref|ZP_04914413.1| dihydrodipicolinate reductase [Burkholderia mallei JHU]
 gi|81604275|sp|Q62H17|DAPB_BURMA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166222618|sp|A3MPI2|DAPB_BURM7 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166222619|sp|A2S5J7|DAPB_BURM9 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166222620|sp|A1V0H0|DAPB_BURMS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|52429109|gb|AAU49702.1| dihydrodipicolinate reductase [Burkholderia mallei ATCC 23344]
 gi|121227762|gb|ABM50280.1| dihydrodipicolinate reductase [Burkholderia mallei SAVP1]
 gi|124292882|gb|ABN02151.1| dihydrodipicolinate reductase [Burkholderia mallei NCTC 10229]
 gi|126241472|gb|ABO04565.1| dihydrodipicolinate reductase [Burkholderia mallei NCTC 10247]
 gi|147746969|gb|EDK54046.1| dihydrodipicolinate reductase [Burkholderia mallei FMH]
 gi|147751957|gb|EDK59024.1| dihydrodipicolinate reductase [Burkholderia mallei JHU]
 gi|160694778|gb|EDP84786.1| dihydrodipicolinate reductase [Burkholderia mallei ATCC 10399]
 gi|238524910|gb|EEP88340.1| dihydrodipicolinate reductase [Burkholderia mallei GB8 horse 4]
 gi|243065220|gb|EES47406.1| dihydrodipicolinate reductase [Burkholderia mallei PRL-20]
          Length = 268

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 159/269 (59%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M+I++ G  GRMG+ LI+ +   P  TL   + R+GS  +GQD G F+G    G+  +
Sbjct: 2   SSMKIAIAGASGRMGRMLIEAVLAAPDATLAGALDRTGSSQLGQDAGAFLG-KQTGVALT 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++       D +IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +
Sbjct: 61  DDIERVCAEADYLIDFTRPEGTLAHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGGKIAL 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V S+NMS+G+N    L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA  
Sbjct: 121 VFSANMSVGVNVTMKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
               L D  V  RH     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R 
Sbjct: 179 TGRTLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRV 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+G+L AA +      G + M+DVLG+
Sbjct: 239 SYAQGALRAARFLAGHQAGFFDMQDVLGL 267


>gi|78065213|ref|YP_367982.1| dihydrodipicolinate reductase [Burkholderia sp. 383]
 gi|90101231|sp|Q39JM8|DAPB_BURS3 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|77965958|gb|ABB07338.1| dihydrodipicolinate reductase [Burkholderia sp. 383]
          Length = 265

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 163/267 (61%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+ SP +GQD G F+G    G+K + +
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDSDAQLVGALDRADSPFLGQDAGTFLG-KETGVKLTAD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQADTLIDFTRPEGTMAHIEAALRHDVKLVIGTTGFTAEQKAELQAAAGKIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  RH     R   SIG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLDDCAVYGRHGVTGERDPSSIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVHFLSARGAGLFDMQDVLGL 264


>gi|229258268|ref|YP_560412.2| dihydrodipicolinate reductase [Burkholderia xenovorans LB400]
          Length = 265

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 160/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+   TL   + R GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDSDATLSGALDRVGSPQLGQDAGAFLG-KQTGVVLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L  + +HN+  +IGTTGF  ++   + + A    I+ 
Sbjct: 60  IERVFAESDYLIDFTRPEGTLVHLEAAQRHNVKMVIGTTGFDNEQKAQLRAAADRIAIMF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SNMS+G+N    L+E AA++   A  +D EI+E HHR K+D+PSGTAL +GE IA+   
Sbjct: 120 ASNMSVGVNVTLKLLEYAAKHF--ATGYDIEIIEAHHRHKVDAPSGTALTMGEVIAHALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  V +R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RNLDDCAVYSREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  + +    G + M+DVLG+
Sbjct: 238 AQGALRAVRFLEGHATGFFDMQDVLGL 264


>gi|261338964|ref|ZP_05966822.1| hypothetical protein ENTCAN_05167 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318793|gb|EFC57731.1| dihydrodipicolinate reductase [Enterobacter cancerogenus ATCC
           35316]
          Length = 273

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 105/271 (38%), Positives = 150/271 (55%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALQLDGVALGAALEREGSSLLGTDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    +H    +IGTTGF     + I   +R+
Sbjct: 61  TVQSSLEAVKDDFDVFIDFTRPEGTLNHLAFCRKHGKGMVIGTTGFDDAGKQAIQDASRD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE 
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIVEAHHRYKVDAPSGTALAMGEV 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA      L D  V  R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAQALDKELKDCAVYAREGHTGERVPGTIGFATVRAGDIVGEHTAIFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW K +  GL+ M DVL
Sbjct: 238 SSRMTFANGAVRSALWLKEKDKGLFDMHDVL 268


>gi|114562152|ref|YP_749665.1| dihydrodipicolinate reductase [Shewanella frigidimarina NCIMB 400]
 gi|122300531|sp|Q086I8|DAPB_SHEFN RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|114333445|gb|ABI70827.1| dihydrodipicolinate reductase [Shewanella frigidimarina NCIMB 400]
          Length = 270

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/280 (38%), Positives = 161/280 (57%), Gaps = 25/280 (8%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + +RI+V+G  GRMG+ LI+       I L + I R+GS LIG D G   G+  M +  +
Sbjct: 3   AKVRIAVVGASGRMGRTLIESAKQQQVIILGAAIERTGSSLIGIDAGVLAGVGAMNVAIT 62

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+L   +   D +IDF+SP  ++  L+  A+++   +IGTTGF+  + E I++++   P+
Sbjct: 63  DSLDKVVNDFDVLIDFTSPESSIIHLDWCAKNHKAIVIGTTGFNHAQKEQINAYSEQVPV 122

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           V + NMS+G+N +  L+  A E +    D+ D EI+E HHR K D+PSGTAL +GE IA 
Sbjct: 123 VLAPNMSVGVNVMWKLLALATEVM---GDYTDIEIIEAHHRHKKDAPSGTALKMGEIIAQ 179

Query: 182 GRKVNLTDHMVLNRHIQQCA----------RTEGSIGIASLRAGSIVGEHSVVIAGEGES 231
                      L R ++QCA          R   +IG A++RAG IVGEH+ + A  GE 
Sbjct: 180 ----------TLGRDLEQCAVFGREGITGERDPNTIGFATVRAGDIVGEHTAMFADIGER 229

Query: 232 ITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           + ++H A  R  FA G++ AA W   Q  GLY M+ VLG+
Sbjct: 230 LEITHKASSRMTFANGAMRAAFWLSDQNAGLYDMQQVLGL 269


>gi|82523844|emb|CAI78587.1| dihydrodipicolinate reductase [uncultured candidate division OP8
           bacterium]
          Length = 267

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G GGRMG+ LI  + +    TL      +  P +G+D+G   GI   G+  + +
Sbjct: 3   MKIGIVGAGGRMGRMLIAAVASAEGATLVGGTESAKHPDLGRDLGALAGIDAQGVALTTD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                ++ D IIDF+ P  T     ++A    V +IGTTG   +  + I   A+ A +V+
Sbjct: 63  ARALFEAADAIIDFTVPTATAMHAAMAADTGTVLVIGTTGLEGQHQDAIERAAKKAALVQ 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N L  LVE AA  L  A  +D EILEMHH  K+D+PSGTAL LG A A GR 
Sbjct: 123 AANYSVGVNVLLGLVEQAARILPEA--FDIEILEMHHHHKVDAPSGTALALGHAAALGRN 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           VNL D     R     AR  G IG A+LR G +VG+H+V+ AG GE + +SH A  R IF
Sbjct: 181 VNLDDVADKVRDGITGARRTGDIGFATLRGGDVVGDHTVMFAGAGERVEISHKASSREIF 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AALWA  Q PGLYSM++VLG+
Sbjct: 241 AAGAVRAALWACDQKPGLYSMKNVLGL 267


>gi|160901438|ref|YP_001567020.1| dihydrodipicolinate reductase [Delftia acidovorans SPH-1]
 gi|160367022|gb|ABX38635.1| Dihydrodipicolinate reductase [Delftia acidovorans SPH-1]
          Length = 278

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 160/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++V G  GRMG+ LI+ I  +  + L + + R+ SP +G D   F+G  P GI    +
Sbjct: 15  LRVAVAGASGRMGRMLIEAIAQSDDLALAAALDRADSPSLGTDPSAFLG-QPSGIAIESD 73

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +  A+   D +IDF+ P  T+  L I A+  +  +IGTTGFS +E   I+ +A+   +V 
Sbjct: 74  VRAALSKADCLIDFTRPEGTMDHLAICAELGVKLVIGTTGFSDEEKARIAEYAQRTAVVL 133

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMS+G+N    L+E AA+ L  +  +D EI+E HHR K+D+PSGTAL +GE IA  + 
Sbjct: 134 SPNMSVGVNVTFKLLEMAAKAL--SSGYDIEIVEAHHRHKVDAPSGTALKMGEVIAEAQG 191

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R     AR + +IG A++R G I+G+H+V+ AG GE I +SH +  R  +
Sbjct: 192 TKLADRAVYERFGHTGAREDNTIGFATVRGGDIIGDHTVLFAGTGERIEISHKSSSRAGY 251

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+GSL AA +   +  G Y M DVLG+
Sbjct: 252 AQGSLRAARFLAGKATGQYDMNDVLGL 278


>gi|165976100|ref|YP_001651693.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|238687492|sp|B0BNW4|DAPB_ACTPJ RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|165876201|gb|ABY69249.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 269

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 151/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  +HN   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVHNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L+    + D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLSQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQAAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKALSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|295677680|ref|YP_003606204.1| dihydrodipicolinate reductase [Burkholderia sp. CCGE1002]
 gi|295437523|gb|ADG16693.1| dihydrodipicolinate reductase [Burkholderia sp. CCGE1002]
          Length = 265

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 158/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+   TL   + R+G+P +GQD G F+G    G+  SD+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDADATLSGALCRTGAPQLGQDAGAFLG-KETGVLLSDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L  + +H++  +IGTTGF   +   + + A+   +V 
Sbjct: 60  IERVFAESDYLIDFTRPDATLAHLEAAQRHDVKMVIGTTGFDNAQKAQLRAAAQKIGVVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SNMS+G+N    L+E AA +   +  +D EI+E HHR K+D+PSGTAL +GE IA    
Sbjct: 120 ASNMSVGVNVTLKLLEYAARHF--STGYDIEIIEAHHRHKVDAPSGTALTMGEVIAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  V  R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RNLDDCAVYGREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  + +    G + M+DVLG+
Sbjct: 238 AQGALRAVRFLEGHDNGFFDMQDVLGL 264


>gi|17547464|ref|NP_520866.1| dihydrodipicolinate reductase oxidoreductase [Ralstonia
           solanacearum GMI1000]
 gi|20978448|sp|Q8XVT2|DAPB_RALSO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|17429767|emb|CAD16452.1| probable dihydrodipicolinate reductase (dhpr). oxidoreductase
           protein [Ralstonia solanacearum GMI1000]
          Length = 263

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 159/267 (59%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R+GS  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGVTLAAALDRAGSDAVGQDAGARLG-KATGVIVTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+ P  TL  L I+ +  +  +IGTTGF+ ++      +     +V 
Sbjct: 60  LRTGLSQADVLIDFTRPEATLAHLEIARELGVGVVIGTTGFTAEQKASFKDYGATIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDVEIVEAHHKHKIDAPSGTALKMGEIVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L +  V  R  +   R  G+IG A++R G IVG+H+V+  GEGE I ++H +  R+ +
Sbjct: 178 TTLAERAVYAREGETGPRMNGTIGFATVRGGDIVGDHTVLFVGEGERIEITHRSNSRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA +   +  GL+ M DVLG+
Sbjct: 238 AEGAVRAACFLAGK-KGLFDMNDVLGL 263


>gi|292493426|ref|YP_003528865.1| dihydrodipicolinate reductase [Nitrosococcus halophilus Nc4]
 gi|291582021|gb|ADE16478.1| dihydrodipicolinate reductase [Nitrosococcus halophilus Nc4]
          Length = 271

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 153/267 (57%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G  GRMG+ LI+       ITL     R  S LIG D G   G+  + I    N
Sbjct: 2   IRVAISGAAGRMGRTLIQAACQYEGITLGVASERPDSSLIGSDAGELAGVGTLQIPLVGN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+   ++ D +IDF+ P ++L +L +        ++GTTGF+ ++ + I+  A   PIV 
Sbjct: 62  LSEHGEAFDLLIDFTQPKVSLANLALCKDQGKAMVVGTTGFTPEQRQEIARAAIEIPIVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA  L    + D EI+E HHR K+D+PSGTAL +GE +A    
Sbjct: 122 APNMSVGVNLCLKLLEMAARVL--GDEVDIEIIEAHHRHKMDAPSGTALRMGEVVAETLG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R   SIG +SLRAG IVGEH+V+ A +GE + + H A  R  F
Sbjct: 180 RDLNQCAVYGRRGFSGERPRESIGFSSLRAGDIVGEHTVMFAADGERVEIGHKASSRMTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ A+ W  S+ PGLY M+DVLG+
Sbjct: 240 ALGAMRASHWVSSKPPGLYDMQDVLGL 266


>gi|170717537|ref|YP_001784626.1| dihydrodipicolinate reductase [Haemophilus somnus 2336]
 gi|189082798|sp|B0UU27|DAPB_HAES2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|168825666|gb|ACA31037.1| Dihydrodipicolinate reductase [Haemophilus somnus 2336]
          Length = 270

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 154/266 (57%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI+ +++   + L +   R GS L+G D G   GI  +GIK +D
Sbjct: 2   TLKIGIVGSGGRMGRQLIQAVYHTEGVELGAAFERVGSSLVGTDAGELAGIGRIGIKVTD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           NL     + D +IDF+ P  T+Q L    + +   +IGTTGF  +  + I   A+N  IV
Sbjct: 62  NLTQEKGNFDILIDFTRPEGTIQHLAFCVEQHKNIVIGTTGFDDQSKQAIQQAAQNIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V +R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFSREGITGERKPDEIGFSTIRAADVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLSTKQEGLFDMTDVL 265


>gi|325983372|ref|YP_004295774.1| dihydrodipicolinate reductase [Nitrosomonas sp. AL212]
 gi|325532891|gb|ADZ27612.1| dihydrodipicolinate reductase [Nitrosomonas sp. AL212]
          Length = 268

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 161/266 (60%), Gaps = 4/266 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I++ G  GRMG+ L++ +   P + L + + R+GSP + +D G  +G +P GI    + 
Sbjct: 5   KIAIAGCSGRMGRTLLEAVTQAPDMRLTAALERTGSPYLNKDAGELIG-TPCGIPIVSDF 63

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A A+   D +IDF+ PA TL  L+I  +  +  +IGTTGFS +E   + + A++  IV +
Sbjct: 64  ANALTDCDHLIDFTRPAGTLAHLSICREIGVKMVIGTTGFSAEEKNQLEAAAKDIAIVFA 123

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N    L+E AA+ L   + +D EI+E HHR K+D+PSGTAL +GE IA   + 
Sbjct: 124 PNMSVGVNVTFKLLEIAAKAL--NEGYDIEIIEAHHRHKVDAPSGTALRMGEVIAQTLQR 181

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L+   V  R      R   +IG A++RAG IVG+H+ + AG GE + +SH A +R  FA
Sbjct: 182 DLSQVAVYGREGVTGERKPETIGFATIRAGDIVGDHTAMFAGIGERVEISHKASNRMTFA 241

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
            G+L A  +   +  GL+ M+DVL +
Sbjct: 242 MGALRATRFLIDKPHGLFDMQDVLSL 267


>gi|189426091|ref|YP_001953268.1| dihydrodipicolinate reductase [Geobacter lovleyi SZ]
 gi|238692138|sp|B3E935|DAPB_GEOLS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|189422350|gb|ACD96748.1| Dihydrodipicolinate reductase [Geobacter lovleyi SZ]
          Length = 266

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 161/271 (59%), Gaps = 12/271 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMGQ +I        I +   + R G P IGQD G   G   +G+  SD+
Sbjct: 2   IKIAVCGAAGRMGQRIIVAAVEAGCI-ISGALERPGHPQIGQDAGLIAGCGQLGVAISDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   ++  D +IDF++P ++L++L +        +IG+TGF+ +E  + +  A++ P V 
Sbjct: 61  LNAVVEGCDVLIDFTTPKISLKNLEVCGLKKKSIVIGSTGFTPEERALAAELAKDIPAVL 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN--G 182
           + NMS+G+N    +++  A+ L    D+D EI+E+HH +K DSPSGTA+ +GE +A   G
Sbjct: 121 APNMSVGVNVCFKMLKDLAKTL--GDDFDVEIVELHHNKKKDSPSGTAVRMGEVVAEALG 178

Query: 183 RKVNLTDHMVLNRHIQQ-CA-RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
           R  N     V N H +  C  RT+  IG+ ++R G IVGEH+V   G GE I +SH A  
Sbjct: 179 RDYN----QVANYHREGICGERTKEEIGMQTVRGGDIVGEHTVYFIGMGERIEISHRAMS 234

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +F+RGS+ AA W   + PGLY M+DVLG+
Sbjct: 235 RDMFSRGSVRAAKWIVGKQPGLYDMQDVLGL 265


>gi|30248628|ref|NP_840698.1| dihydrodipicolinate reductase [Nitrosomonas europaea ATCC 19718]
 gi|39931086|sp|Q82WP9|DAPB_NITEU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|30180223|emb|CAD84525.1| Dihydrodipicolinate reductase [Nitrosomonas europaea ATCC 19718]
          Length = 268

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 164/269 (60%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P+ I+V G  GRMG+A+++ I     + L + + + G+P + QD G+  G +P G+  S
Sbjct: 2   TPLNIAVAGSTGRMGRAIMETIAEADDLRLSAALEQPGNPYLSQDAGSLTG-TPPGVAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +   A+   D ++DF+ PA TL  L    +  +  +IGTTGFS +E ++I + A++  I
Sbjct: 61  SDYVSALAGSDILVDFTRPAGTLSHLATCRKLGVRMVIGTTGFSPEEKDIIRNAAQDIAI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N L  L+E AA+ L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VLAPNMSVGVNLLFRLLEVAAKAL--PEGYDVEIIEAHHRHKVDAPSGTALRMGEVIAQA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           +  +L    +  R      R   +IG +++R G IVG+H+ + AG GE + ++H A  R+
Sbjct: 179 QSRDLEKVAIYGREGNTGERRADTIGFSTIRGGDIVGDHTALFAGIGERLEITHKASSRK 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G+L AA +  ++  GL+ M+DVLG+
Sbjct: 239 TFAAGALHAARFLMTRKSGLFDMQDVLGL 267


>gi|116252747|ref|YP_768585.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257395|emb|CAK08490.1| putative dihydrodipicolinate reductase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 256

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 153/271 (56%), Gaps = 21/271 (7%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           SP++I+V G  GRMG+A++  +  +P       I R GS                G    
Sbjct: 3   SPIKIAVAGASGRMGRAILPLLAADPDFAFVGGIGREGS---------------AGDGLI 47

Query: 63  DNLAMAIQSVDGIIDFSS--PALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120
           D  A AI + D I+DF++   A  L  L  SA    + +IG TGF   E E I+  AR  
Sbjct: 48  DRSA-AIGAADVILDFTTGRAAAELVGLCASAGGPAL-VIGATGFEPDELERIAEAARTI 105

Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180
           PI++S N S+G+N L  LV  AA  L PA  WD EILE HH RK+D+PSGTAL+LGEA A
Sbjct: 106 PILRSGNFSIGVNMLVGLVAQAARAL-PAHGWDIEILEAHHNRKIDAPSGTALMLGEAAA 164

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
            GR V+L       R      R  G IG A LRAG +VGEHSV+ A   E +TLSHSA D
Sbjct: 165 EGRGVSLASVERRGRDGITGERPPGEIGFAVLRAGGLVGEHSVLFAAAEEVVTLSHSALD 224

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R +FARG+L AA W   + PG Y+M DVLG+
Sbjct: 225 RGMFARGALAAARWIAGRAPGEYAMGDVLGL 255


>gi|187925356|ref|YP_001896998.1| dihydrodipicolinate reductase [Burkholderia phytofirmans PsJN]
 gi|187716550|gb|ACD17774.1| Dihydrodipicolinate reductase [Burkholderia phytofirmans PsJN]
          Length = 254

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 155/256 (60%), Gaps = 3/256 (1%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+ LI+ + N+   TL   + R+GSP +GQD G F+G    G+  +D++       D +
Sbjct: 1   MGRMLIETVLNDSDATLSGALDRAGSPQLGQDAGAFLG-KQTGVVLTDDVERVFAESDYL 59

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF+ P  TL  L  + +HN+  +IGTTGF  ++   + + A    I+ S+NMS+G+N  
Sbjct: 60  IDFTRPEGTLMHLEAAQRHNVKMVIGTTGFDNEQKAQLRAAADKIAIMFSANMSVGVNVT 119

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L+E AA++   A  +D EI+E HHR K+D+PSGTAL++GE IAN    NL D  V +R
Sbjct: 120 LKLLEFAAKHF--ATGYDIEIIEAHHRHKVDAPSGTALVMGEVIANALGRNLDDCAVYSR 177

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                 R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +A+G+L A  + 
Sbjct: 178 EGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSYAQGALRAVRFL 237

Query: 256 KSQIPGLYSMRDVLGI 271
           +S   G + M+DVLG+
Sbjct: 238 ESHATGFFDMQDVLGL 253


>gi|262373867|ref|ZP_06067145.1| dihydrodipicolinate reductase [Acinetobacter junii SH205]
 gi|262311620|gb|EEY92706.1| dihydrodipicolinate reductase [Acinetobacter junii SH205]
          Length = 273

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 105/272 (38%), Positives = 155/272 (56%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  SP RI +LG GGRMG+ LI+ +       L + + R  S L+G D G   G+  +G+
Sbjct: 1   MSTSP-RIGILGAGGRMGRILIQAVQE-AGYQLAAAVERPESSLVGADAGELAGVGSLGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K   +LA  ++  D +IDF++PA T Q L +  +  +  +IGTTG S ++   +   A  
Sbjct: 59  KIVGSLAEVLKDCDVVIDFTAPAATEQHLKLCREAGVAMVIGTTGMSEEQKAFLDESATQ 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D EI+E HHR K+D+PSGTA ++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEIIEAHHRHKVDAPSGTAFMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGYTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG 
Sbjct: 237 NRMNFASGAVRAAAWVVGREARKYDMKDVLGF 268


>gi|262166437|ref|ZP_06034174.1| dihydrodipicolinate reductase [Vibrio mimicus VM223]
 gi|262026153|gb|EEY44821.1| dihydrodipicolinate reductase [Vibrio mimicus VM223]
          Length = 229

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 98/228 (42%), Positives = 138/228 (60%), Gaps = 2/228 (0%)

Query: 44  IGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTT 103
           +G D+G   GI   GI   DNL  A++  D IIDF++P  TL +L +  QH    +IGTT
Sbjct: 1   MGVDIGELCGIGKQGIVLVDNLEQAVKQFDVIIDFTAPVSTLANLALCEQHGKKLVIGTT 60

Query: 104 GFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRR 163
           GFS  + + I   A+N PIV + N S+G+N +  L+E AA+ +      D EI+E HHR 
Sbjct: 61  GFSDDQRQTIEQAAKNIPIVMAPNYSVGVNLVFKLLEKAAKVM--GDYCDIEIVEAHHRH 118

Query: 164 KLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSV 223
           K+D+PSGTA+ +GEAIA+     L+D  V  R      R+   IG A++RAG I+GEH+ 
Sbjct: 119 KVDAPSGTAIGMGEAIAHAMGNQLSDVAVYAREGITGERSRNEIGFATIRAGDIIGEHTA 178

Query: 224 VIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           + A  GE + ++H A DR  FA G++ AA+W   Q  G Y+M DVLG+
Sbjct: 179 MFADIGERVEITHKATDRMTFANGAVKAAIWLAEQPAGFYTMTDVLGL 226


>gi|332285192|ref|YP_004417103.1| dihydrodipicolinate reductase [Pusillimonas sp. T7-7]
 gi|330429145|gb|AEC20479.1| dihydrodipicolinate reductase [Pusillimonas sp. T7-7]
          Length = 263

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 107/265 (40%), Positives = 157/265 (59%), Gaps = 5/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI++ G  GRMG+ LI+ +  +P + L   + RSGSP +GQD G  +G +  G+  SD+
Sbjct: 1   MRIAIAGADGRMGRMLIEAVTQSPDLELTVALDRSGSPALGQDAGALLGRNT-GVLISDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+ + D +IDF+ P  TL  L    +H    +IGTTGF  +  + I +  +   +V 
Sbjct: 60  LD-ALANADCLIDFTRPEGTLAHLQACIKHGTKCVIGTTGFDEQGKQAIQAAGQKIAVVF 118

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L++ AA+ L     +D E+ E HHR K+D+PSGTAL +GEA+AN   
Sbjct: 119 APNMSVGVNATLKLLDMAAKLLNSG--YDVEVFEAHHRNKVDAPSGTALAMGEAVANAWG 176

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D +   RH +  AR  G IG + LR G IVG+H+V   G GE I ++H +  R  +
Sbjct: 177 KRLDDIVDWARHGETGARETGKIGFSVLRGGDIVGDHTVYFCGTGERIEITHRSSSRATY 236

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+GSL AA +   +  GL+ M+DVL
Sbjct: 237 AQGSLRAARYLARKEFGLFDMQDVL 261


>gi|91775130|ref|YP_544886.1| dihydrodipicolinate reductase [Methylobacillus flagellatus KT]
 gi|91709117|gb|ABE49045.1| dihydrodipicolinate reductase [Methylobacillus flagellatus KT]
          Length = 267

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 155/258 (60%), Gaps = 3/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG AL++ +  +  + LH  + R+ SP IG+D G  +G    G+K + ++A AI+  D
Sbjct: 11  GRMGHALLEGVFEDDGLELHGALDRADSPQIGRDAGEQLG-RKTGVKVTADVAAAIRGAD 69

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            ++DF+ P  +L+ L    +  +  +IGTTGFS  + + I   A++  IV + NMS+G+ 
Sbjct: 70  VLVDFTRPEPSLEYLEACRRAGVKLVIGTTGFSAGQKQQIERAAQDVAIVFAPNMSVGVT 129

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV+ AA+ L   + +D EI+E HHR K+D+PSGTAL LGEA A     NL +  + 
Sbjct: 130 LLISLVQAAAKVL--NQGYDVEIIEAHHRFKVDAPSGTALRLGEAAAEALGRNLEEAAIY 187

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R   +IG A++R G +VG+H+V+ AG GE + L+H A  R  FA G+L AA 
Sbjct: 188 GRQGVTGERDPNTIGFATVRGGDVVGDHTVLFAGIGERMELTHKASSRATFALGALRAAK 247

Query: 254 WAKSQIPGLYSMRDVLGI 271
           +   +  GLY M+DVLG+
Sbjct: 248 FLADRRVGLYDMQDVLGL 265


>gi|303250409|ref|ZP_07336607.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252235|ref|ZP_07534132.1| hypothetical protein appser6_7530 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650735|gb|EFL80893.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860157|gb|EFM92173.1| hypothetical protein appser6_7530 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 269

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 150/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  +HN   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVHNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L     + D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLNQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQTAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|198284376|ref|YP_002220697.1| dihydrodipicolinate reductase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218665224|ref|YP_002427040.1| dihydrodipicolinate reductase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248897|gb|ACH84490.1| Dihydrodipicolinate reductase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218517437|gb|ACK78023.1| dihydrodipicolinate reductase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 276

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 153/259 (59%), Gaps = 4/259 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+AL++ I  +P + L + I RSG+  +G+D G   G+  +G+  + +L  A+  +D
Sbjct: 14  GRMGRALVQAIVAHPELQLVAAIGRSGAAYLGEDAGRLAGVQALGLPVTADLGGALADLD 73

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +I+F      L  +          ++GTTGFS+ +   + + +R+ P+V + NMS+G+N
Sbjct: 74  VLIEFGPVEAALAHVAACVAVAKPVVVGTTGFSMNQRAELENASRHIPLVLAPNMSVGVN 133

Query: 134 -FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMV 192
             L FL    A        +D EI+E HHR K+D+PSGTAL LG A+A GR   L +   
Sbjct: 134 VLLAFLPAITAAL---GDGYDVEIVEAHHRHKMDAPSGTALALGRAVAKGRGQRLDEVQC 190

Query: 193 LNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAA 252
           L+R+     R  GSIG A+LR   +VGEH+V +AG GE + L+H A  R  FA G+L AA
Sbjct: 191 LDRNGIPGPRMAGSIGFATLRGADVVGEHTVWMAGTGERLELTHRASSRLNFAEGALRAA 250

Query: 253 LWAKSQIPGLYSMRDVLGI 271
            W + + PGLY M+DVLG+
Sbjct: 251 SWLRGRAPGLYDMQDVLGL 269


>gi|300690441|ref|YP_003751436.1| dihydrodipicolinate reductase(DHPR) [Ralstonia solanacearum PSI07]
 gi|299077501|emb|CBJ50127.1| dihydrodipicolinate reductase(DHPR) [Ralstonia solanacearum PSI07]
          Length = 263

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 160/267 (59%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R+GS  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGVTLAAALDRAGSDAVGQDAGAKLG-KATGVIITDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL  L+++ +  +  +IGTTGF+ ++      +     +V 
Sbjct: 60  VRTGLSQADVLIDFTRPEATLAHLDVARELGVGVVIGTTGFTAEQKASFKGYGAAIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDIEIIEAHHKHKIDAPSGTALKMGEIVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L +  V  R  +   R  G+IG A++R G IVG+H+V+  GEGE I ++H +  R+ +
Sbjct: 178 TTLAERAVYAREGETGPRVSGTIGFATVRGGDIVGDHTVLFVGEGERIEITHRSNSRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA +   +  GL+ M DVLG+
Sbjct: 238 AEGAVRAACFLAGK-TGLFDMNDVLGL 263


>gi|251788193|ref|YP_003002914.1| dihydrodipicolinate reductase [Dickeya zeae Ech1591]
 gi|247536814|gb|ACT05435.1| dihydrodipicolinate reductase [Dickeya zeae Ech1591]
          Length = 273

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 153/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G     +
Sbjct: 1   MRDAQIRVAIAGAGGRMGRQLIQAALQMEGVVLGAALEREGSSLLGSDAGELAGAGKTDV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L   +   D  IDF+ P  TL+ L    QH    +IGTTGF  +    I   A +
Sbjct: 61  TVQSSLEAVVNDFDVFIDFTRPEGTLKHLAFCRQHGKGMVIGTTGFDEQGKAAIQQAATD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L +  V  R      R   SIG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALGRDLKECAVYAREGYTGERDPKSIGFATIRAGDIVGEHTAMFADVGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW  ++  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGAVRSALWVSARKHGLFDMRDVLGL 270


>gi|330950319|gb|EGH50579.1| dihydrodipicolinate reductase [Pseudomonas syringae Cit 7]
          Length = 235

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 141/234 (60%), Gaps = 2/234 (0%)

Query: 38  RSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIV 97
           R  S L+G D G    +  +G+  S +LA      D +IDF+ P++TL++L    +    
Sbjct: 3   RPDSTLVGADAGELAALGRIGVPLSGDLARGADEFDVLIDFTHPSVTLKNLAFCRKAGKA 62

Query: 98  HIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEIL 157
            IIGTTGFS +E   +    ++ PIV ++N S+G+N    L++TAA  L    + D EI 
Sbjct: 63  MIIGTTGFSAEEKLRLEEAGKDIPIVFAANFSVGVNLCLKLLDTAARVL--GDEVDIEIT 120

Query: 158 EMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSI 217
           E HHR K+D+PSGTAL +GE +AN    +L    V  R  Q  AR   +IG A++RAG +
Sbjct: 121 EAHHRHKVDAPSGTALRMGEVVANALGRDLEKVAVYGREGQTGARDRQTIGFATIRAGDV 180

Query: 218 VGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           VG+H+V+ A +GE + ++H A  R  FA+G++ AA+W   + PGLY M+DVLG+
Sbjct: 181 VGDHTVLFAADGERVEITHKASSRMTFAKGAVRAAMWLDGKAPGLYDMQDVLGL 234


>gi|254483092|ref|ZP_05096326.1| dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2148]
 gi|214036614|gb|EEB77287.1| dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2148]
          Length = 269

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 155/267 (58%), Gaps = 4/267 (1%)

Query: 7   RISVLGG-GRMGQALIKEIH-NNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +I + G  GRMG+ LI+ I  ++  + L + I    S L+G D G   G+   G+    +
Sbjct: 4   KIGITGAAGRMGRTLIEAIAASSDDLQLAAAIEHPESSLLGADAGELAGLGKNGVVVVAS 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   I ++D +IDF+ PA T+ ++   A+  I  +IGTTGF+ ++  +I + A    + K
Sbjct: 64  LDSVISNIDVLIDFTVPAATIANVQACAEQGIGIVIGTTGFTAEQQAIIDTAAMKTAVCK 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SN S G+N    L++ AA  L    D D E+ E HHR K+D+PSGTAL +G+ +A+   
Sbjct: 124 ASNFSTGVNVCFKLLDMAARVL--GDDVDIEVYEAHHRHKVDAPSGTALSMGQVVADALD 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R  Q  AR    IG A++RAG IVG+H+V  A EGE + ++H A  R  F
Sbjct: 182 RDLDKVAVYGREGQTGAREREIIGFATVRAGDIVGDHTVTFAAEGERVEITHKASSRMSF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
            RG++ AA W K+Q  GLY M+DVLG+
Sbjct: 242 GRGAVRAAGWLKAQNAGLYDMQDVLGL 268


>gi|39995271|ref|NP_951222.1| dihydrodipicolinate reductase [Geobacter sulfurreducens PCA]
 gi|81703639|sp|Q74GT5|DAPB_GEOSL RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|39982033|gb|AAR33495.1| dihydrodipicolinate reductase [Geobacter sulfurreducens PCA]
          Length = 266

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 154/266 (57%), Gaps = 4/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I+V G  GRMGQ +I         T+   + R G  ++GQD G   G   +G+  SD+L
Sbjct: 3   KIAVCGAAGRMGQRIIVAARE-AGCTISGALERPGHEMVGQDAGLIAGCGALGVAISDDL 61

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
              ++  D +IDF++P ++L++L + A      +IG+TGF+ +E  +    AR  P V +
Sbjct: 62  NAVVEGCDVLIDFTTPKVSLKNLEVCALKKKSIVIGSTGFTPEERALAVELAREIPAVLA 121

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N    +++  A+ L    D+D EI+E+HH +K D+PSGTA+ +GE +A     
Sbjct: 122 PNMSVGVNVCFKILKDVAKTL--GDDFDVEIVELHHNKKKDAPSGTAVRMGEVVAEALGR 179

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +       +R      RT+  IG+ ++R G IVGEH+V   G GE I +SH A  R +F+
Sbjct: 180 DYNKVATYHREGICGERTKEEIGMQTVRGGDIVGEHTVYFIGMGERIEISHRAMTRDMFS 239

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RGS+ AA W   + PGLY M+DVLG+
Sbjct: 240 RGSVRAAQWVVGKAPGLYDMQDVLGL 265


>gi|294142078|ref|YP_003558056.1| dihydrodipicolinate reductase [Shewanella violacea DSS12]
 gi|293328547|dbj|BAJ03278.1| dihydrodipicolinate reductase [Shewanella violacea DSS12]
          Length = 270

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 157/268 (58%), Gaps = 5/268 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ GG GRMG+ LI+      +I L + I R+ S LIG D G   G+  M +  +D+
Sbjct: 5   VRVAITGGSGRMGRTLIEAARTQSAIYLGAAIERASSTLIGVDAGELAGVGSMKVAITDS 64

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+SP  ++      A++    +IGTTGFS  + E+I S+A   PIV 
Sbjct: 65  LDKVVDDFDVLIDFTSPQASVNHAQWCARNGKAIVIGTTGFSDAQKELIVSYAETTPIVM 124

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           + NM++G+N +  L+E  A+ +    D+ D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 125 APNMAVGVNLMWKLLELTAKVM---GDYTDIEIIEGHHRYKKDAPSGTALKMGEVIAETL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG +++RAG IVGEH+ + A  GE + ++H A  R  
Sbjct: 182 GRDLNKCAVYGREGITGERDRETIGFSTIRAGDIVGEHTAMFADIGERLEITHKATSRMT 241

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ A++W  ++  GLY M+ VLG+
Sbjct: 242 FANGAMRASVWLVNKDSGLYDMQQVLGL 269


>gi|209517546|ref|ZP_03266386.1| Dihydrodipicolinate reductase [Burkholderia sp. H160]
 gi|209502079|gb|EEA02095.1| Dihydrodipicolinate reductase [Burkholderia sp. H160]
          Length = 265

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 157/267 (58%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+   TL   + R+G+  +GQD G F+G    G+  SD+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDADATLSGALCRAGAAQLGQDAGAFLG-KETGVLLSDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L  + +HN+  +IGTTGF   +   + +  +   +V 
Sbjct: 60  IERVFAESDYLIDFTRPDATLAHLEAAQRHNVKMVIGTTGFDNAQKAQLRAAGQKIGVVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SNMS+G+N    L+E AA +   +  +D EI+E HHR K+D+PSGTAL +GE IAN   
Sbjct: 120 ASNMSVGVNVTLKLLEYAARHF--STGYDIEIIEAHHRHKVDAPSGTALTMGEVIANALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  V  R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RNLDDCAVYGREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  + +    G + M+DVLG+
Sbjct: 238 AQGALRAVRFLEGHDNGFFDMQDVLGL 264


>gi|146329390|ref|YP_001209471.1| dihydrodipicolinate reductase [Dichelobacter nodosus VCS1703A]
 gi|146232860|gb|ABQ13838.1| dihydrodipicolinate reductase [Dichelobacter nodosus VCS1703A]
          Length = 274

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 156/268 (58%), Gaps = 13/268 (4%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQ---DVGNFVGISPMGIKF 61
           M I++ G  G+MGQ + K +  +    L +  VR G   +G+   DVG+F       +K 
Sbjct: 14  MNIAIHGISGKMGQEIAKAVLADAQCQLVAASVREGHAWLGKPLSDVGDFAS----DLKP 69

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
             NL +  ++ D ++DF+ P  T   LN+  + N   +IGTTGF+ +    I   A + P
Sbjct: 70  VSNLELLCRA-DVVVDFTRPDATFAMLNVCRRFNTSLMIGTTGFTAETRRWIEQAAEDLP 128

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           IV + N S+GI  L  L    A+ +LP ++WD EILE HHRRK+D+PSGTAL LGE IA 
Sbjct: 129 IVLAENTSIGITILCELTRKLAQ-VLPPEEWDAEILEFHHRRKIDAPSGTALRLGEEIAA 187

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
            R+V L+D    + +  Q AR  G IG +SLR G IVGEH+V    + E I L+H A +R
Sbjct: 188 ARQVVLSD---CSCYPHQQARKNGQIGFSSLRGGDIVGEHTVYFIHDDERIELTHRAQNR 244

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVL 269
            +FA+G++ AA W   +  GLY+M DVL
Sbjct: 245 SVFAKGAVLAAKWLVGKPKGLYTMSDVL 272


>gi|183600999|ref|ZP_02962492.1| hypothetical protein PROSTU_04614 [Providencia stuartii ATCC 25827]
 gi|188019331|gb|EDU57371.1| hypothetical protein PROSTU_04614 [Providencia stuartii ATCC 25827]
          Length = 273

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 162/271 (59%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +R++++G GGRMG+ LI+   N   I L + I R GS L+G D G   G+  +GI
Sbjct: 1   MANSMVRVAIVGAGGRMGRQLIQATQNQEGIRLGAAIERVGSSLVGTDAGELAGVGKLGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
              D L   +   D +IDF+ P  TL  L     ++   +IGTTGF  +  + I+  A++
Sbjct: 61  AVVDTLDKVVDDFDVVIDFTRPEGTLNYLAFCRANHKAMVIGTTGFDDQGKQAIAEAAKS 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            PIV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE+
Sbjct: 121 IPIVFAANFSVGVNLVLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGES 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L +  V  R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALGKDLKECAVYAREGHTGEREAGTIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ A+ W  +Q  GLY+M+DVL
Sbjct: 238 SSRMTFANGAIKASAWVVAQNAGLYNMKDVL 268


>gi|298504276|gb|ADI82999.1| dihydrodipicolinate reductase [Geobacter sulfurreducens KN400]
          Length = 266

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 154/266 (57%), Gaps = 4/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I+V G  GRMGQ +I         T+   + R G  ++GQD G   G   +G+  SD+L
Sbjct: 3   KIAVCGAAGRMGQRIIVAARE-AGCTISGALERPGHEMVGQDAGLIAGCGALGVAISDDL 61

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
              ++  D +IDF++P ++L++L + A      +IG+TGF+ +E  +    AR  P V +
Sbjct: 62  NAVVEGCDVLIDFTTPKVSLKNLEVCAIKKKSIVIGSTGFTPEERALAVELAREIPAVLA 121

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N    +++  A+ L    D+D EI+E+HH +K D+PSGTA+ +GE +A     
Sbjct: 122 PNMSVGVNVCFKILKDVAKTL--GDDFDVEIVELHHNKKKDAPSGTAVRMGEVVAEALGR 179

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +       +R      RT+  IG+ ++R G IVGEH+V   G GE I +SH A  R +F+
Sbjct: 180 DYNKVATYHREGICGERTKEEIGMQTVRGGDIVGEHTVYFIGMGERIEISHRAMTRDMFS 239

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RGS+ AA W   + PGLY M+DVLG+
Sbjct: 240 RGSVRAAQWVVGKAPGLYDMQDVLGL 265


>gi|170695374|ref|ZP_02886520.1| Dihydrodipicolinate reductase [Burkholderia graminis C4D1M]
 gi|170139774|gb|EDT07956.1| Dihydrodipicolinate reductase [Burkholderia graminis C4D1M]
          Length = 254

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/256 (39%), Positives = 151/256 (58%), Gaps = 3/256 (1%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+ LI+ + N+   TL   + R GSP +GQD G FVG    G+  +D++       D +
Sbjct: 1   MGRMLIETVLNDSDATLSGALDRPGSPQLGQDAGAFVG-KQTGVALTDDIERVFAESDYL 59

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF+ P  TL  L  + +HN+  +IGTTGF   +   + + A N  I+ +SNMS+G+N  
Sbjct: 60  IDFTRPEGTLVHLEAAQRHNVKMVIGTTGFDNAQKAQLRAAADNVAIMFASNMSVGVNVT 119

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L+E AA++   A  +D EI+E HHR K+D+PSGTAL +GE IAN    NL D  V  R
Sbjct: 120 LKLLEFAAKHF--ATGYDIEIIEAHHRHKVDAPSGTALTMGEVIANALGRNLDDCAVYGR 177

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                 R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +A+G+L A  + 
Sbjct: 178 EGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSYAQGALRAVRFL 237

Query: 256 KSQIPGLYSMRDVLGI 271
           +    G + M+DVLG+
Sbjct: 238 EGHQTGFFDMQDVLGL 253


>gi|56551603|ref|YP_162442.1| dihydrodipicolinate reductase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761271|ref|ZP_04759359.1| Dihydrodipicolinate reductase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260752804|ref|YP_003225697.1| dihydrodipicolinate reductase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|81598293|sp|Q5NPM9|DAPB_ZYMMO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|56543177|gb|AAV89331.1| Dihydrodipicolinate reductase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374178|gb|EER63675.1| Dihydrodipicolinate reductase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258552167|gb|ACV75113.1| dihydrodipicolinate reductase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 254

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 154/270 (57%), Gaps = 20/270 (7%)

Query: 3   QSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
           +S ++I ++G  GRMG+A I+E  +   I L   I R G+     + G++          
Sbjct: 4   ESSVKIGLIGAAGRMGKA-IQEAASQQDIQLSGGIGRKGA-----EFGSY--------ND 49

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           S++LA A    D +IDFS+ A    ++  +  H    IIGTTG +  ++++I   A   P
Sbjct: 50  SESLAKA---SDVLIDFSTAAALKDNIEAALHHKKPIIIGTTGLTEADHQLIEQAASKIP 106

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           ++ ++N SLG+N L  LV+ AA  L    DWD EI+EMHHR K D+PSGTALLLG A A 
Sbjct: 107 VILAANTSLGVNMLAALVKQAAAKL--GSDWDIEIVEMHHRHKKDAPSGTALLLGRAAAE 164

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR   L D   L R      R  G IG ASLR GS+ G+H VV A EGE I L H A  R
Sbjct: 165 GRGEKLEDIADLQRCPATEPRETGRIGFASLRGGSVAGDHMVVFASEGERIELGHRAESR 224

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            IFARG+L AALW   Q  G Y M+DVLG+
Sbjct: 225 IIFARGALKAALWLADQSAGFYQMKDVLGL 254


>gi|167648922|ref|YP_001686585.1| dihydrodipicolinate reductase [Caulobacter sp. K31]
 gi|167351352|gb|ABZ74087.1| Dihydrodipicolinate reductase [Caulobacter sp. K31]
          Length = 274

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 151/264 (57%), Gaps = 23/264 (8%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG AL + +       +     R G             +   G+  SD   +A+   +
Sbjct: 26  GRMGLALARTLEGRTDAVVTGRFDRPG-------------VEGEGLVASD---IALAGAE 69

Query: 74  GIIDFSSP----ALTLQSLNISAQHN--IVHIIGTTGFSVKENEVISSFARNAPIVKSSN 127
            +IDF+ P    AL      +S +       +IG+TGFS ++N  I++ A    IVKS N
Sbjct: 70  VVIDFTIPEASVALAEACAALSGKDGGGPALVIGSTGFSDEQNARIAAAATKVAIVKSGN 129

Query: 128 MSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNL 187
            SLG+N L  LV  AA  +LPA DWD E+ E HH+RK+D+PSGTAL+LG+A A+GR V L
Sbjct: 130 YSLGVNMLMGLVRQAA-AVLPAADWDIEVHEAHHKRKIDAPSGTALMLGQAAADGRGVGL 188

Query: 188 TDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARG 247
                  R      R EG+IG + +R G I+GEHSV+ AGE E +TLSHSA DR +FARG
Sbjct: 189 GQVADRARDGVTGPRKEGAIGFSVVRGGGIIGEHSVIFAGEEEVLTLSHSATDRGLFARG 248

Query: 248 SLTAALWAKSQIPGLYSMRDVLGI 271
           ++ AALW + + PGLY M+DVLG 
Sbjct: 249 AVAAALWVRGRPPGLYDMQDVLGF 272


>gi|296160456|ref|ZP_06843272.1| dihydrodipicolinate reductase [Burkholderia sp. Ch1-1]
 gi|295889205|gb|EFG69007.1| dihydrodipicolinate reductase [Burkholderia sp. Ch1-1]
          Length = 265

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 159/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+   TL   + R GSP +GQD G F+G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDADATLSGALDRVGSPQLGQDAGAFLG-KQTGVVLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +       D +IDF+ P  TL  L  + +H +  +IGTTGF  ++   + + A    I+ 
Sbjct: 60  IERVFAESDYLIDFTRPEGTLVHLEAAQRHKVKMVIGTTGFDNEQKAQLRAAADRIAIMF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SNMS+G+N    L+E AA++   A  +D EI+E HHR K+D+PSGTAL +GE IA+   
Sbjct: 120 ASNMSVGVNVTLKLLEYAAKHF--ATGYDIEIIEAHHRHKVDAPSGTALTMGEVIAHALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            NL D  V +R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RNLDDCAVYSREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  + +    G + M+DVLG+
Sbjct: 238 AQGALRAVRFLEGHATGFFDMQDVLGL 264


>gi|121998256|ref|YP_001003043.1| dihydrodipicolinate reductase [Halorhodospira halophila SL1]
 gi|166222639|sp|A1WX29|DAPB_HALHL RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|121589661|gb|ABM62241.1| dihydrodipicolinate reductase [Halorhodospira halophila SL1]
          Length = 267

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 143/257 (55%), Gaps = 2/257 (0%)

Query: 15  RMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDG 74
           RMG+ LI+ +H  P + + +   R+G   +G+D G   G   +G+   D++  A+ + D 
Sbjct: 13  RMGRMLIEVVHRQPGVHVAAATDRTGGEAVGRDAGELAGQGSLGVPIGDDIPAAVAASDA 72

Query: 75  IIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINF 134
           +IDFS P  T       A+     ++GTTG    + E +   A    ++ ++N S G+  
Sbjct: 73  VIDFSLPEATETVAAACAEAGRPLVLGTTGLGETQREAVHRLAEQVAVMHAANYSTGVTL 132

Query: 135 LGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLN 194
           L  LVE AA  +      D EI+E HHR K+D+PSGTAL LGEA+A+    +L+   V  
Sbjct: 133 LTALVEQAARAI--GVYSDIEIIEAHHRHKVDAPSGTALRLGEAVADALGRDLSQCAVYG 190

Query: 195 RHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALW 254
           R      R   +IG  ++RAG IVG+H+V+  G+GE + L+H A  R  FA G++ AA W
Sbjct: 191 REGHTGERDPQTIGFETIRAGDIVGDHTVLFGGDGERVELTHKASSRTTFASGAVRAAAW 250

Query: 255 AKSQIPGLYSMRDVLGI 271
              Q PGLY MRD++G+
Sbjct: 251 VVEQPPGLYDMRDMIGV 267


>gi|320540426|ref|ZP_08040076.1| dihydrodipicolinate reductase [Serratia symbiotica str. Tucson]
 gi|320029357|gb|EFW11386.1| dihydrodipicolinate reductase [Serratia symbiotica str. Tucson]
          Length = 273

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 151/272 (55%), Gaps = 3/272 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +R+++ G  GRMG+ LI+ +     + L + + R GS L+G D G   GI  +GI
Sbjct: 1   MTGSHIRMAIAGASGRMGRQLIRAVQQAEGVVLGAALSRPGSSLVGVDAGELAGIGTVGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L   +   D +IDF+ P  TL+ L+         +IGTTGF       I + A++
Sbjct: 61  TLSDSLDKVVDDFDILIDFTRPEGTLRYLDFCVAQRKAMVIGTTGFDDAGKRAIRNAAQH 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IGIVFAANFSVGVNLVLKLLEKAAQVM--GDSSDIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L D  V  R      R   SIG A+LRAG IVGEHS +    GE + ++H A 
Sbjct: 179 AGALGRDLKDCAVYAREGHTGERDPRSIGFATLRAGDIVGEHSAMFVDIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            R  FA G++ AA W      GL+ M DVL +
Sbjct: 239 SRMTFASGAVRAASWLYKHDKGLFDMHDVLSL 270


>gi|170768501|ref|ZP_02902954.1| dihydrodipicolinate reductase [Escherichia albertii TW07627]
 gi|170122605|gb|EDS91536.1| dihydrodipicolinate reductase [Escherichia albertii TW07627]
          Length = 273

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 152/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF       I + A +
Sbjct: 61  IVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKLAIRNAAED 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+     L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKELQDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAIRSALWLSGKKSGLFDMRDVL 268


>gi|157147554|ref|YP_001454873.1| dihydrodipicolinate reductase [Citrobacter koseri ATCC BAA-895]
 gi|166222630|sp|A8ALS4|DAPB_CITK8 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|157084759|gb|ABV14437.1| hypothetical protein CKO_03354 [Citrobacter koseri ATCC BAA-895]
          Length = 273

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 155/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAALGMDGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A++
Sbjct: 61  TVQSSLEAVKDDFDIFIDFTRPEGTLAHLAFCRQHGKGIVIGTTGFDDAGKQAIRDAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L    V +R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAHALDKDLKACAVYSREGYTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W KS+  GL+ M DVL +
Sbjct: 238 SSRMTFANGAVRSAIWLKSKPNGLFDMSDVLNL 270


>gi|311280980|ref|YP_003943211.1| dihydrodipicolinate reductase [Enterobacter cloacae SCF1]
 gi|308750175|gb|ADO49927.1| dihydrodipicolinate reductase [Enterobacter cloacae SCF1]
          Length = 273

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 151/270 (55%), Gaps = 3/270 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   GI   G+
Sbjct: 1   MHDAQIRVAIAGAGGRMGRQLIQAATQLDGVRLGAALEREGSSLLGCDAGELAGIGHTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L     +    +IGTTGF     + I S A+ 
Sbjct: 61  TVQSSLEAVKADFDVFIDFTRPEGTLAHLAFCRANGKGMVIGTTGFDDAGKQAIQSAAQE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
             IV ++N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GEAI
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM--GSYTDIEIIEAHHRHKVDAPSGTALAMGEAI 178

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L    V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A 
Sbjct: 179 AGALDKDLKSCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKAS 238

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
            R  FA G++ +ALW K +  GL+ MRDVL
Sbjct: 239 SRMTFANGAVRSALWLKGKKNGLFDMRDVL 268


>gi|115350600|ref|YP_772439.1| dihydrodipicolinate reductase [Burkholderia ambifaria AMMD]
 gi|122324037|sp|Q0BIB8|DAPB_BURCM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|115280588|gb|ABI86105.1| dihydrodipicolinate reductase [Burkholderia ambifaria AMMD]
          Length = 265

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 162/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+    L   + R+ SP +GQD G F+G    G+K +D+
Sbjct: 1   MKIAIAGASGRMGRMLIEAVLNDSDAQLVGALDRADSPFLGQDAGAFLG-KETGVKLTDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L       D +IDF+ P  T+  +  + +H +  +IGTTGF+ ++   + + A    IV 
Sbjct: 60  LDAVFAQADYLIDFTRPEGTIAHVAAALRHEVKLVIGTTGFTAEQKAELQAAAARIGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A    
Sbjct: 120 AANMSVGVNVTLKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L D  V  R      R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RSLEDCAVYGRQGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  +  ++  GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLSARGAGLFDMQDVLGL 264


>gi|307256704|ref|ZP_07538483.1| hypothetical protein appser10_7070 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306864752|gb|EFM96656.1| hypothetical protein appser10_7070 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 269

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 150/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNTEGVELGAAFEREGSSLVGADAGEVAGIGTTGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L+    + D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLSQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQAAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|297180934|gb|ADI17137.1| dihydrodipicolinate reductase [uncultured gamma proteobacterium
           HF0070_08D07]
          Length = 248

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/247 (40%), Positives = 145/247 (58%), Gaps = 2/247 (0%)

Query: 24  IHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPAL 83
           +  +   TL       G+ L+GQD G   GI   G+  S      I+  + +IDFSSP+ 
Sbjct: 3   VQASNEFTLSGAFESDGNELLGQDAGELAGIGKCGVLLSATDRSLIEQAEVMIDFSSPSA 62

Query: 84  TLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAA 143
           ++ +  I A+     +IGTTG   ++  ++   A   PI  S NMSLG++ L  LVE+A 
Sbjct: 63  SIFNAEICAEVVTALVIGTTGIDFEQEGLLKKLADKVPIFMSPNMSLGMSMLYRLVESAV 122

Query: 144 EYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCART 203
             L   KD+D EI E HH  K D+PSGTAL LGE +A  R V+L +  V +R   + +R 
Sbjct: 123 STL--GKDFDVEIFEAHHSGKKDAPSGTALRLGEVVAAARAVDLQEKAVFDRSGDKRSRE 180

Query: 204 EGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLY 263
             SIG +S+R GSI G+H+V++AG+GE + L+H A+DRR F  G+L AA +  ++ PGLY
Sbjct: 181 PDSIGFSSVRGGSIAGDHTVILAGDGERLELTHRAHDRRNFVHGALLAASFICAKQPGLY 240

Query: 264 SMRDVLG 270
            M D+LG
Sbjct: 241 GMSDLLG 247


>gi|254491142|ref|ZP_05104323.1| dihydrodipicolinate reductase [Methylophaga thiooxidans DMS010]
 gi|224463655|gb|EEF79923.1| dihydrodipicolinate reductase [Methylophaga thiooxydans DMS010]
          Length = 267

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/258 (37%), Positives = 149/258 (57%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+ LI+ +     + L + I R+ S L+G D G   G+  +G+  + ++A A +  D
Sbjct: 12  GRMGRCLIQAVDQTDGLELSAAIDRADSSLLGADAGELAGVGKLGVAITADVAQATKDSD 71

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            IIDF+ P +T+  L     ++   +IGTTGF   + + I   A+   ++ + NMS+G+N
Sbjct: 72  IIIDFTLPEVTMALLPHCVANHCRPVIGTTGFDDAQKQTIDEAAKQVAVILAPNMSVGVN 131

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
               L++ AA  L    D D EI+E HHR K+D+PSGTAL +GE +A+    +L    V 
Sbjct: 132 LSLKLLDIAARVL--GDDVDIEIVEAHHRHKVDAPSGTALRMGEVVADALGRDLKQCAVY 189

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R  +   R   +IG A+LRAG IVG+H+V+ A EGE + ++H A  R  FA G++ A+ 
Sbjct: 190 GREGRTGERDRDTIGFATLRAGDIVGDHTVMFAAEGERVEITHKASSRMTFAFGAMRASA 249

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W      GL+ M+DVLG+
Sbjct: 250 WLMQHKNGLFDMQDVLGL 267


>gi|300703050|ref|YP_003744652.1| dihydrodipicolinate reductase(dhpr) [Ralstonia solanacearum
           CFBP2957]
 gi|299070713|emb|CBJ42008.1| dihydrodipicolinate reductase(DHPR) [Ralstonia solanacearum
           CFBP2957]
          Length = 263

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 158/267 (59%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R+GS  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGMTLAAALDRAGSDAVGQDAGAKLG-KATGVIITDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL  L I+ +  +  +IGTTGF+ ++      +     +V 
Sbjct: 60  VRAGLSQADVLIDFTRPEATLAHLEIARELGVGVVIGTTGFTAEQKASFKDYGTAIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDVEIIEAHHKHKIDAPSGTALKMGEVVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L +  V  R      R  G+IG A++R G IVG+H+V+  GEGE I ++H +  R+ +
Sbjct: 178 TTLAERAVYAREGDTGPRANGTIGFATVRGGDIVGDHTVLFIGEGERIEITHRSNSRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA +   +  GL+ M DVLG+
Sbjct: 238 AEGAVRAACFLAGK-KGLFDMNDVLGL 263


>gi|50122793|ref|YP_051960.1| dihydrodipicolinate reductase [Pectobacterium atrosepticum
           SCRI1043]
 gi|81643853|sp|Q6D0C7|DAPB_ERWCT RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|49613319|emb|CAG76770.1| dihydrodipicolinate reductase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 273

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 155/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M    +RI+V+G GGRMG+ LI+ I     + L + + RSGS L+G D G   G+   GI
Sbjct: 1   MKDLSIRIAVVGAGGRMGRQLIQAIEQMDGVVLGAALERSGSSLLGSDAGELAGLGKNGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             +++L       D +IDF+ P  TL  L     H    IIGTTGF       I   A++
Sbjct: 61  TVNESLDAVQNDFDILIDFTRPEGTLAHLAFCRLHRKGMIIGTTGFDDAGKAAIKQAAQD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE 
Sbjct: 121 IGIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEV 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L    V  R      R   SIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADALGRDLKSCAVYTREGHTGERDPKSIGFATVRAGDIVGEHTAMFADIGERVEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ AA+W  S+  G++ MRDVL +
Sbjct: 238 SSRMTFANGAVRAAIWISSKESGIFDMRDVLSL 270


>gi|303252397|ref|ZP_07338563.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247656|ref|ZP_07529697.1| hypothetical protein appser2_6500 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307261146|ref|ZP_07542823.1| hypothetical protein appser12_7080 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|302648856|gb|EFL79046.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855824|gb|EFM87986.1| hypothetical protein appser2_6500 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306869176|gb|EFN00976.1| hypothetical protein appser12_7080 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 269

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 150/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L+    + D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLSQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQTAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|83746766|ref|ZP_00943814.1| DapB [Ralstonia solanacearum UW551]
 gi|83726535|gb|EAP73665.1| DapB [Ralstonia solanacearum UW551]
          Length = 263

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 158/267 (59%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMGQ LI  +   P +TL + + R+GS  +GQD G  +G    G+  +D+
Sbjct: 1   MKIAIAGASGRMGQMLIDTVLRTPGVTLAAALDRAGSDAVGQDAGAKLG-KATGVIITDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL  L I+ +  +  +IGTTGF+ ++      +     +V 
Sbjct: 60  VRAGLSQADVLIDFTRPEATLAHLEIARELGVGVVIGTTGFTAEQKASFKGYGTAIGVVW 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  + 
Sbjct: 120 APNMSVGVNATFKLIEVAAKIL--AQGYDVEIIEAHHKHKIDAPSGTALKMGEVVAEAQG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L +  V  R      R  G+IG A++R G IVG+H+V+  GEGE I ++H +  R+ +
Sbjct: 178 TALAERAVYAREGDTGPRVNGTIGFATVRGGDIVGDHTVLFIGEGERIEITHRSNSRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA +   +  GL+ M DVLG+
Sbjct: 238 AEGAVRAACFLAGK-KGLFDMNDVLGL 263


>gi|254787222|ref|YP_003074651.1| dihydrodipicolinate reductase [Teredinibacter turnerae T7901]
 gi|259586140|sp|C5BQ31|DAPB_TERTT RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|237686457|gb|ACR13721.1| dihydrodipicolinate reductase [Teredinibacter turnerae T7901]
          Length = 268

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 145/266 (54%), Gaps = 3/266 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI+V G GGRMG+ LI+ +       L + I R  S L+G D G   GI  +G+    +L
Sbjct: 4   RIAVTGAGGRMGKILIEAVSLAGGAQLTAAIERPTSSLLGADAGELAGIGKLGVPVVGDL 63

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A  +   D +IDF++P  TL +  + A      ++GTTGFS  E         + P+  +
Sbjct: 64  AEVVDGFDVLIDFTAPVATLANAKVCAAAGKGMVVGTTGFSGAEKAEFDETVTSIPVCMA 123

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           SN S G+N    L++ AA  L    D D EI E HHR K+D+PSGTAL +GE +AN    
Sbjct: 124 SNFSTGVNLCFKLLDMAASVL--GDDVDIEICEAHHRHKVDAPSGTALSMGEVVANAVGR 181

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           NL D  V  R  Q  AR   +IG A++R G +VG+H+V    +GE + +SH A  R  F 
Sbjct: 182 NLKDVAVYGREGQTGARERNTIGFATVRGGDVVGDHTVSFLADGERVEISHKASSRMSFG 241

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG++ AA W   +    Y M+DVLG+
Sbjct: 242 RGAVRAATWLLGKPASRYDMQDVLGL 267


>gi|261867680|ref|YP_003255602.1| dihydrodipicolinate reductase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413012|gb|ACX82383.1| dihydrodipicolinate reductase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 270

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 150/266 (56%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I+V+G GGRMG+ LI+ ++N   + L +   R GS L+G D G   GI  +GIK  D
Sbjct: 2   TLKIAVVGAGGRMGRQLIQAVYNAEGVELGAAFERKGSSLVGADAGELAGIGNLGIKVGD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L  A    D +IDF+ P  TL+ L     +    +IGTTGF       I S A    IV
Sbjct: 62  DLNAAKDRFDLLIDFTRPEGTLEHLAFCVTNRKKIVIGTTGFDDAGKAAIKSAAEKTAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L +H V  R      R    IG +++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKNHGVFCRDGIIGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W + +  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLEGKNNGLFDMTDVL 265


>gi|260913906|ref|ZP_05920380.1| dihydrodipicolinate reductase [Pasteurella dagmatis ATCC 43325]
 gi|260631993|gb|EEX50170.1| dihydrodipicolinate reductase [Pasteurella dagmatis ATCC 43325]
          Length = 270

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            +RI+V+G GGRMG+ LI+ +     ++L +   R GS L+G D G   GI  +G+K +D
Sbjct: 2   TLRIAVVGAGGRMGRQLIQAVTEAEGVSLGAAFERQGSSLVGTDAGELAGIGTIGVKVTD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +LA      D +IDF+ P  TL  L     H    +IGTTGF  +    I   +    IV
Sbjct: 62  DLASQKDQFDLLIDFTRPEGTLAHLAFCVAHQKAMVIGTTGFDDEGKTKIKQASDKIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKTHGVFAREGITGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEIAHKATSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA+G++ AA W   +  GL+ M DVL
Sbjct: 240 FAKGAVRAAKWVADKQSGLFDMTDVL 265


>gi|226953293|ref|ZP_03823757.1| dihydrodipicolinate reductase [Acinetobacter sp. ATCC 27244]
 gi|226835919|gb|EEH68302.1| dihydrodipicolinate reductase [Acinetobacter sp. ATCC 27244]
          Length = 273

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 105/272 (38%), Positives = 155/272 (56%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  SP RI +LG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSTSP-RIGILGAGGRMGRILIQAVQQ-AGYQLAAAVERPESSLVGADAGELAGIGNIGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K   +L+  ++  D +IDF++P  T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVVGSLSEVLKDCDVVIDFTAPVATEQHLKLCREAGVAMVIGTTGMSDEQKAFLDETATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+GIN    L+E AA+        D EI+E HHR K+D+PSGTA ++GEAI
Sbjct: 119 TPVVYAANYSVGINVSIKLLELAAKVF--GDTVDIEIIEAHHRHKVDAPSGTAFMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGYTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG 
Sbjct: 237 NRMNFASGAVRAAAWVVGRKAQKYDMKDVLGF 268


>gi|71906575|ref|YP_284162.1| dihydrodipicolinate reductase [Dechloromonas aromatica RCB]
 gi|90101237|sp|Q47HI9|DAPB_DECAR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|71846196|gb|AAZ45692.1| dihydrodipicolinate reductase [Dechloromonas aromatica RCB]
          Length = 268

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 159/269 (59%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S  RI V+G GGRMG+ LI+    +  + L +     GSP +G+  G  VG+ P  +  +
Sbjct: 2   SATRIGVVGAGGRMGRMLIEATLKDDRLVLGAAFDVPGSPALGKTAGELVGL-PCDVVVT 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++A  ++++D +IDF+ P  TL  L +  +  +  +IGTTGF      VI+  A++ P+
Sbjct: 61  DDVAAGLKNIDCLIDFTRPQGTLVHLELCRKAGVGMVIGTTGFEADGKAVIAEAAKDIPV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NM++G+N    L+ETAA  L   + +D EI+E HHR K+D+PSGTAL +GE +A+ 
Sbjct: 121 VFAPNMAVGVNVAFKLLETAARIL--NQGYDIEIVEAHHRLKVDAPSGTALRMGEVVASA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R      R   +IG A++R G IVG+H+V+  G GE + ++H A  R 
Sbjct: 179 LGRDLEECAVYGREGVTGERDPSTIGFATVRGGDIVGDHTVMFCGIGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A GSL AA +      GL+ M+DVLG+
Sbjct: 239 PYALGSLRAARFMAGHKSGLFDMQDVLGL 267


>gi|94497577|ref|ZP_01304146.1| dihydrodipicolinate reductase [Sphingomonas sp. SKA58]
 gi|94422994|gb|EAT08026.1| dihydrodipicolinate reductase [Sphingomonas sp. SKA58]
          Length = 242

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 136/219 (62%), Gaps = 5/219 (2%)

Query: 54  ISPMGIKFSDN-LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEV 112
           I+P G+  SD+ LA+A +S D +IDFS+PA     L      +   +IGTTG     + +
Sbjct: 28  ITP-GVAMSDDPLALAERS-DILIDFSAPAALSAHLEACITAHKPILIGTTGLEATHHAL 85

Query: 113 ISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTA 172
           I   A N P++++ N SLG+N L  LVE AA  L   +DWD EI+EMHHR K+D+PSGTA
Sbjct: 86  IDEAAANIPVLQTGNTSLGVNLLAALVEQAAAGL--GEDWDIEIVEMHHRHKVDAPSGTA 143

Query: 173 LLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESI 232
           LLLGEA A GR + L DH    R      RT G+IG A+LR GS+ G+H V+ A EGE I
Sbjct: 144 LLLGEAAARGRGIVLADHSERGRDGITGPRTPGTIGFAALRGGSVAGDHQVIFAAEGERI 203

Query: 233 TLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            + H A +R IFARG++  ALW   Q  G Y M+ VLG+
Sbjct: 204 EIGHRAENRTIFARGAVKGALWLAGQPAGRYDMKAVLGL 242


>gi|322514451|ref|ZP_08067492.1| dihydrodipicolinate reductase [Actinobacillus ureae ATCC 25976]
 gi|322119639|gb|EFX91704.1| dihydrodipicolinate reductase [Actinobacillus ureae ATCC 25976]
          Length = 269

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 151/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L+    + D +IDF+ P  TL+ +     +    +IGTTGF     + I   A    IV
Sbjct: 62  DLSQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDAAGKQAIQMAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKIL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG++VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGITGERKRDEIGFATIRAGNVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W +++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLQTKQNGLFDMTDVL 264


>gi|144898435|emb|CAM75299.1| Dihydrodipicolinate reductase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 254

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 148/253 (58%), Gaps = 3/253 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G  GRMG+ L+  + +     L     R GS LIG+DVG  +G   +G    +N
Sbjct: 1   MKIGIVGCAGRMGRMLMNAVADTTGCQLSGGTERPGSALIGKDVGEVLGRDALGAFIGEN 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
            +    + D +IDF++PA T+    ++A+   + I+GTTG S  +   ++  A+   IV 
Sbjct: 61  PSALFAASDAVIDFTAPAATVAHAVLAAEMGTILIVGTTGLSKDDEAKLAEAAKKTTIVY 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N L  L E AA  L    D+D EI+EMHHR K+D+PSGTAL LG A A GR 
Sbjct: 121 APNFSVGVNLLMALTERAAAIL--GDDYDIEIVEMHHRHKVDAPSGTALGLGRAAAKGRA 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L      +R     AR +G IG A+LR G +VG+H+V+ A EGE + LSH A  R +F
Sbjct: 179 VALDSVWCKSRDGHPGARPKGEIGFATLRGGDVVGDHTVMFAAEGERMELSHKASSRAVF 238

Query: 245 ARGSLTAALWAKS 257
           A+G++ AA   ++
Sbjct: 239 AKGAVRAACGPRT 251


>gi|126208164|ref|YP_001053389.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae L20]
 gi|190149993|ref|YP_001968518.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307263322|ref|ZP_07544940.1| hypothetical protein appser13_7410 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|166222610|sp|A3N048|DAPB_ACTP2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238692386|sp|B3H1A7|DAPB_ACTP7 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|126096956|gb|ABN73784.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189915124|gb|ACE61376.1| dihydrodipicolinate reductase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306871384|gb|EFN03110.1| hypothetical protein appser13_7410 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 269

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 149/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L     + D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLNQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQTAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|307254494|ref|ZP_07536330.1| hypothetical protein appser9_7400 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258952|ref|ZP_07540683.1| hypothetical protein appser11_7490 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306862544|gb|EFM94502.1| hypothetical protein appser9_7400 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866976|gb|EFM98833.1| hypothetical protein appser11_7490 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 269

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 150/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L+    + D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLSQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQTAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGIIGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|319764773|ref|YP_004128710.1| dihydrodipicolinate reductase [Alicycliphilus denitrificans BC]
 gi|330826989|ref|YP_004390292.1| dihydrodipicolinate reductase [Alicycliphilus denitrificans K601]
 gi|317119334|gb|ADV01823.1| dihydrodipicolinate reductase [Alicycliphilus denitrificans BC]
 gi|329312361|gb|AEB86776.1| dihydrodipicolinate reductase [Alicycliphilus denitrificans K601]
          Length = 273

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 156/268 (58%), Gaps = 4/268 (1%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P R++V G  GRMG+ LI+ I  +    L   +    SP +GQD   F+G +  G+  + 
Sbjct: 8   PRRVAVAGASGRMGRMLIEAIQASDDCVLAGALDLPTSPAVGQDATAFLGRAS-GVAITA 66

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L   +++ D +IDF+ P  TL    + A+  +  +IGTTGFS  +   + + AR   IV
Sbjct: 67  DLREGLKNADVLIDFTRPEGTLAHAAVCAELGVQMVIGTTGFSDAQKADMEAAARKVAIV 126

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            + NMS+G+N    L++ AA+ L  A  +D EI+E HH+ K+D+PSGTAL +GE IA  +
Sbjct: 127 LAPNMSVGVNVTLKLLQMAAQAL--ATGYDIEIIEAHHKHKVDAPSGTALKMGEVIAEAQ 184

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
              L D  V  R+     R EGSIG A++R G IVG+H+V+ AG GE + ++H +  R  
Sbjct: 185 GTRLADRAVYERYGHTGERKEGSIGFATVRGGDIVGDHTVLFAGTGERVEITHKSSSRAG 244

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +A+GSL A  +   Q  G++ M DVL +
Sbjct: 245 YAQGSLRAVRFLAGQRAGMFDMFDVLNL 272


>gi|260366312|ref|ZP_05778764.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus K5030]
 gi|308114729|gb|EFO52269.1| dihydrodipicolinate reductase [Vibrio parahaemolyticus K5030]
          Length = 240

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 141/234 (60%), Gaps = 2/234 (0%)

Query: 38  RSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIV 97
           R  S L+G D+G   G     +  +D+L   + + D +IDF+ P  TL +L +  QH   
Sbjct: 6   RPESSLVGVDIGELCGEGKFDVFLTDDLEKEVDNFDVVIDFTVPVSTLANLELCKQHGKS 65

Query: 98  HIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEIL 157
            +IGTTGFS +E  +I + A++ P+V + N S+G+N +  L+E AA+ +      D EI+
Sbjct: 66  IVIGTTGFSEEERALIDAVAKHVPVVMAPNYSVGVNLVFKLLEKAAKVM--GDYCDVEIV 123

Query: 158 EMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSI 217
           E HHR K+D+PSGTA+ +GEAIA      L+D  V  R      RT+  IG A++RAG I
Sbjct: 124 EAHHRHKVDAPSGTAIGMGEAIAGAMGNKLSDVAVYAREGITGERTKDEIGFATIRAGDI 183

Query: 218 VGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           VGEH+ + A  GE + ++H A DR  FA G++ AA+W  S+  G Y+M DVLG+
Sbjct: 184 VGEHTAMFADIGERVEITHKATDRMTFANGAVKAAVWLHSKPAGFYTMTDVLGL 237


>gi|110833177|ref|YP_692036.1| dihydrodipicolinate reductase [Alcanivorax borkumensis SK2]
 gi|110646288|emb|CAL15764.1| dihydrodipicolinate reductase [Alcanivorax borkumensis SK2]
          Length = 275

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 98/267 (36%), Positives = 151/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ ++G  GRMG+ LI+    NP  TL + +   GS LIG D G  VG    G+   D+
Sbjct: 1   MKVGIIGAAGRMGRILIEATLANPDTTLAAAVDVPGSSLIGADAGELVGQGACGVLLVDD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  +   D  IDF+ P  T+++L +        +IGTTG   ++   + +   +  I  
Sbjct: 61  LAKVVNEADVFIDFTVPEATVKNLEVCRAAGTRLVIGTTGLDDEQKAAVRAAGDDIAICF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N    L+ETAA+ +    + D E++E HHR K+D+PSGTAL +GE +A    
Sbjct: 121 APNYSIGVNLCFKLLETAAQIM--GDEVDIEVIEAHHRHKIDAPSGTALRMGEVVAQTLG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L++  V  R  +   R   +IG  ++RAG IVG+H+V+ A EGE + ++H A  R  F
Sbjct: 179 RDLSECAVYGREGRTGERERHTIGFETIRAGDIVGDHTVMFAAEGERVEITHKASSRMSF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
            RG++ AA W      GL+ M+DVLG+
Sbjct: 239 GRGAVRAAAWLGRHDKGLFDMQDVLGL 265


>gi|228879505|ref|YP_459006.2| dihydrodipicolinate reductase [Erythrobacter litoralis HTCC2594]
          Length = 242

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 2/197 (1%)

Query: 75  IIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINF 134
           ++DFS+P     +L+ +    I  +IGTTG     +  I++ AR  PI+++ N SLG+  
Sbjct: 48  LVDFSAPGALQGNLHAAIGAGIPLVIGTTGLGESHHTAINNAARAVPILQTGNTSLGVTL 107

Query: 135 LGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLN 194
           L  LV  AA  L P  DWD EI+EMHHR K+D+PSGTALLLGEA A GR + L D+    
Sbjct: 108 LAHLVREAASKLGP--DWDIEIVEMHHRHKVDAPSGTALLLGEAAAQGRGIELADNTESG 165

Query: 195 RHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALW 254
           R      R EG+IG A+LR G++ GEHSV++AGE E +T SHSA +R IFARG++ AA W
Sbjct: 166 RDGHTVERAEGAIGFAALRGGTVAGEHSVILAGEQERLTFSHSAENRLIFARGAVKAAEW 225

Query: 255 AKSQIPGLYSMRDVLGI 271
              +  G Y+M DVLG+
Sbjct: 226 LIGKQAGRYAMADVLGL 242


>gi|90416144|ref|ZP_01224076.1| Dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2207]
 gi|90331869|gb|EAS47083.1| Dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2207]
          Length = 267

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 153/266 (57%), Gaps = 3/266 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI++ G GGRMG+ALI  I  N    L   + R  S LIG D G   G+   G+  + ++
Sbjct: 3   RIAITGAGGRMGKALIDAILLNGGAELTVALERPESSLIGVDSGELAGVGKNGVLVASSI 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
                  D +IDFS P+ T  +    A HN   +IGTTG   ++   +S+ A ++ I  +
Sbjct: 63  IDVADQFDVLIDFSVPSATAANAAFCAAHNKKMVIGTTGLDAEQLAQVSTTAASSAICMA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           SN S G+N    L E AA+ L  A + D EILE HHR K+D+PSGTAL LGE++A     
Sbjct: 123 SNFSTGVNLCFKLAELAAKVL--ADETDIEILEAHHRHKVDAPSGTALSLGESVAAAVGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R  Q  AR   +IG A++R G IVG+H+V+ AGEGE + ++H A  R  FA
Sbjct: 181 DLKKVAVYGREGQTGARDHETIGFATVRGGDIVGDHTVLFAGEGERVEITHKASSRLAFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           RG++ AA W   +  GL+ M+DVLG+
Sbjct: 241 RGAVRAAQWLGQKDSGLFDMQDVLGL 266


>gi|84788027|gb|ABC64209.1| dihydrodipicolinate reductase [Erythrobacter litoralis HTCC2594]
          Length = 230

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 2/197 (1%)

Query: 75  IIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINF 134
           ++DFS+P     +L+ +    I  +IGTTG     +  I++ AR  PI+++ N SLG+  
Sbjct: 36  LVDFSAPGALQGNLHAAIGAGIPLVIGTTGLGESHHTAINNAARAVPILQTGNTSLGVTL 95

Query: 135 LGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLN 194
           L  LV  AA  L P  DWD EI+EMHHR K+D+PSGTALLLGEA A GR + L D+    
Sbjct: 96  LAHLVREAASKLGP--DWDIEIVEMHHRHKVDAPSGTALLLGEAAAQGRGIELADNTESG 153

Query: 195 RHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALW 254
           R      R EG+IG A+LR G++ GEHSV++AGE E +T SHSA +R IFARG++ AA W
Sbjct: 154 RDGHTVERAEGAIGFAALRGGTVAGEHSVILAGEQERLTFSHSAENRLIFARGAVKAAEW 213

Query: 255 AKSQIPGLYSMRDVLGI 271
              +  G Y+M DVLG+
Sbjct: 214 LIGKQAGRYAMADVLGL 230


>gi|242238043|ref|YP_002986224.1| dihydrodipicolinate reductase [Dickeya dadantii Ech703]
 gi|242130100|gb|ACS84402.1| dihydrodipicolinate reductase [Dickeya dadantii Ech703]
          Length = 273

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 155/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+V G GGRMG+ LI+ + N     L + + R GS L+G D G   G+  + +
Sbjct: 1   MKDSSIRIAVAGAGGRMGRQLIQAVSNAEGAVLGAALERQGSSLVGSDAGELAGLGKLNV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L       D +IDF+ P  TL  L    QH    IIGTTGF       I   +  
Sbjct: 61  TVSDSLEAVKDDFDVLIDFTRPEGTLAHLAFCRQHAKAMIIGTTGFDDAGKTAIQQASAE 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNLLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L +  V  R      R   SIG A++RAG IVGEH+ +    GE I ++H A
Sbjct: 178 IADALGRDLKECAVYAREGYTGERDPKSIGFATVRAGDIVGEHTAMFVDIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ A++W K+   GL+ MRDVLG+
Sbjct: 238 SSRMTFANGAVRASIWLKAHNKGLFDMRDVLGL 270


>gi|145588419|ref|YP_001155016.1| dihydrodipicolinate reductase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145046825|gb|ABP33452.1| dihydrodipicolinate reductase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 267

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 161/267 (60%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+P   L   +  +  P +G+D G+F+G    G+  S +
Sbjct: 2   MKIAIAGATGRMGRMLIETVFNSPDAQLVGALEHNSCPQLGEDAGSFLG-KKTGVIISSD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +A  + + + +IDF+ P  T+  L ++ +     IIGTTG S ++   +   +    IV 
Sbjct: 61  VAAVLANAEFLIDFTRPDGTMAHLAVAEKTGTKMIIGTTGLSSEQIGDLKKASAKLAIVF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L   + +D EI+E HHR K+D+PSGTAL +GE IA    
Sbjct: 121 APNMSVGVNATFKLLEIAAKML--NEGYDIEIVEAHHRHKVDAPSGTALKMGEVIAEALG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      R  GSIG A++R G IVG+H+V+ AG+GE I +SH +  R+ +
Sbjct: 179 EKLDDVAVYAREGHTGERKPGSIGFATIRGGDIVGDHTVLFAGDGERIEISHKSSSRQSY 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+GSL AA + ++Q  GLY M+DVLG+
Sbjct: 239 AQGSLRAARFLQNQTFGLYDMQDVLGL 265


>gi|325578288|ref|ZP_08148423.1| dihydrodipicolinate reductase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160024|gb|EGC72153.1| dihydrodipicolinate reductase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 270

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +HN     L +   R GS L+G D G   GI  +GIK SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHNAEGTELGAAFERKGSSLVGADAGELAGIGALGIKVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L     + D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLNAEKDNFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDDVGKAAIQAASEKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W + Q  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLEKQSHGLFDMTDVL 265


>gi|327392677|dbj|BAK10099.1| dihydrodipicolinate reductase DapB [Pantoea ananatis AJ13355]
          Length = 271

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 154/266 (57%), Gaps = 5/266 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+++G  GRMG+ LI+ +     + L + + R GS LIG D G   GI   G+   D+
Sbjct: 4   IRIAIVGAPGRMGRNLIQAVAQLEGVELGAALARPGSSLIGSDAGELAGIGHAGVTLRDD 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+ P  TL+ L I  +H    IIGTTGF       I   A +  IV 
Sbjct: 64  LRAVVDDFDVVIDFTRPEGTLEYLAICREHRKAMIIGTTGFDAAGKAAIRDAAADIGIVF 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEAIA   
Sbjct: 124 AANFSVGVNLVLKLLEKAAKVM---GDYADIEIIEAHHRHKVDAPSGTALAMGEAIAEAM 180

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
              L +H V +R      R   +IG A++RAG IVGEH+ + A EGE I ++H A  R  
Sbjct: 181 DWKLDEHAVYSREGHTGERKANTIGFATVRAGDIVGEHTALFADEGERIEITHKASSRMT 240

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA+W      GLY MRDVL
Sbjct: 241 FANGAVKAAIWVSENKTGLYDMRDVL 266


>gi|307311516|ref|ZP_07591158.1| dihydrodipicolinate reductase [Escherichia coli W]
 gi|331666263|ref|ZP_08367144.1| dihydrodipicolinate reductase [Escherichia coli TA271]
 gi|306908495|gb|EFN38993.1| dihydrodipicolinate reductase [Escherichia coli W]
 gi|315059256|gb|ADT73583.1| dihydrodipicolinate reductase [Escherichia coli W]
 gi|323380187|gb|ADX52455.1| dihydrodipicolinate reductase [Escherichia coli KO11]
 gi|324118382|gb|EGC12276.1| dihydrodipicolinate reductase [Escherichia coli E1167]
 gi|331066474|gb|EGI38351.1| dihydrodipicolinate reductase [Escherichia coli TA271]
          Length = 273

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 154/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW  S+  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSSKESGLFDMRDVL 268


>gi|296283105|ref|ZP_06861103.1| dihydrodipicolinate reductase [Citromicrobium bathyomarinum JL354]
          Length = 242

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 148/258 (57%), Gaps = 26/258 (10%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQA+   I +      H++   +G+   G+DV      S +                
Sbjct: 11  GRMGQAIAAAIESGE----HTL---AGAVDKGEDVAGLADRSEV---------------- 47

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDFS+P     +L+ +    +  +IGTTG     +  I + AR   ++++ N SLG+ 
Sbjct: 48  -LIDFSAPQALESNLHAAVGAGVPLLIGTTGLEEHHHTAIDNAARAVAVLQTGNTSLGVT 106

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV  AA  L  A+ WD EI+EMHHR K+D+PSGTALLLGEA A+GR ++L  +   
Sbjct: 107 MLARLVREAAGAL--AQGWDVEIVEMHHRAKVDAPSGTALLLGEAAASGRGIDLAQNSER 164

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR +G+IG ASLR G++ GEHSV++AGE E I LSH A DR +FARG+LT A 
Sbjct: 165 GRDGHTGARGDGAIGFASLRGGTVAGEHSVILAGENERIVLSHVAEDRTLFARGALTGAD 224

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG YSM DVLGI
Sbjct: 225 WLIGKPPGRYSMEDVLGI 242


>gi|85709435|ref|ZP_01040500.1| dihydrodipicolinate reductase [Erythrobacter sp. NAP1]
 gi|85688145|gb|EAQ28149.1| dihydrodipicolinate reductase [Erythrobacter sp. NAP1]
          Length = 242

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 141/258 (54%), Gaps = 26/258 (10%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQAL   I        H++ V       G D+G   G               +   D
Sbjct: 11  GRMGQALADAIKQAG----HNLCV-------GVDLGGEPG-------------KLVAKCD 46

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            I+DFS+P     +L  +    +  +IGTTG        I   A+  P++++ N SLG+ 
Sbjct: 47  VIVDFSAPDALAANLKAATSAGVPILIGTTGLEPSHFSAIDEAAKAIPVLQTGNTSLGVT 106

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV  AA  L    DWD E+LEMHHR K+D+PSGTA LLGEA A  R ++L+D+M  
Sbjct: 107 LLSALVREAASRL--GDDWDIEVLEMHHRAKVDAPSGTAKLLGEAAAEARGIDLSDNMES 164

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            RH     R EG IG A+LR G++ GEHSV+ AG  E +TLSHSA +R IFARG++  A 
Sbjct: 165 GRHGYTGERGEGHIGFATLRGGTVAGEHSVIFAGNEERLTLSHSAENRMIFARGAVRGAE 224

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG YSM DVLG+
Sbjct: 225 WLMGKEPGRYSMEDVLGL 242


>gi|254427086|ref|ZP_05040793.1| dihydrodipicolinate reductase [Alcanivorax sp. DG881]
 gi|196193255|gb|EDX88214.1| dihydrodipicolinate reductase [Alcanivorax sp. DG881]
          Length = 275

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 98/267 (36%), Positives = 152/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M++ ++G  GRMG+ LI+    NP  TL + +   GS LIG D G  VG    G+  +D+
Sbjct: 1   MKVGIIGAAGRMGRILIEATLANPDTTLAAAVDVPGSSLIGADAGELVGQGSSGVLLADD 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L+  +   D  IDF+ P  T+++L +        +IGTTG    +   + + + +  I  
Sbjct: 61  LSKVVNDADVFIDFTVPEATVKNLEVCRAAGTKLVIGTTGLDDAQKAALRAASDDIAICF 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N    L+ETAA+ +    + D E++E HHR K+D+PSGTAL +GE +A    
Sbjct: 121 APNYSIGVNLCFKLLETAAQIM--GDEVDIEVIEAHHRHKIDAPSGTALRMGEVVAQTLG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R  +   R   +IG  ++RAG IVG+H+V+ A EGE + ++H A  R  F
Sbjct: 179 RDLNECAVYGREGRTGERERHTIGFETIRAGDIVGDHTVMFAAEGERVEITHKASSRMSF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
            RG++ AA W  S   GL+ M+DVLG+
Sbjct: 239 GRGAVRAAAWLGSHDKGLFDMQDVLGL 265


>gi|330829111|ref|YP_004392063.1| dihydrodipicolinate reductase [Aeromonas veronii B565]
 gi|328804247|gb|AEB49446.1| Dihydrodipicolinate reductase [Aeromonas veronii B565]
          Length = 312

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 156/271 (57%), Gaps = 5/271 (1%)

Query: 3   QSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
            +P+R++V+G  GRMG+ L++ I N   + + + + R GS +IG D G   G+  +G+  
Sbjct: 44  DNPIRVAVMGCNGRMGKVLLEAITNTDGVVVGAALERPGSAVIGLDAGELNGLGHLGVAI 103

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           SD+L       D IIDF+ P +TL +L  +  H+   +IGTTGF       +    +   
Sbjct: 104 SDSLDKVRDEFDLIIDFTRPEVTLANLAFALAHHKQMVIGTTGFDDAGKAALKEAGKQIG 163

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIA 180
           IV +SN S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE +A
Sbjct: 164 IVFASNYSVGVNLVFKLLEQAAKVM---GDYTDIEIIEGHHRHKVDAPSGTALSMGEVVA 220

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
                +L +  V  R      R   +IG A++RAG +VGEH+V+ A  GE + +SH A  
Sbjct: 221 KTLGRDLKECAVYGREGITGERDRNTIGFATIRAGDLVGEHTVMFADIGERVEISHKASS 280

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R  FA G++ A  W   Q  GLY M+DVL +
Sbjct: 281 RLTFANGAVRAGKWLGQQGAGLYDMQDVLNL 311


>gi|134280492|ref|ZP_01767203.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 305]
 gi|134248499|gb|EBA48582.1| dihydrodipicolinate reductase [Burkholderia pseudomallei 305]
          Length = 254

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/256 (38%), Positives = 151/256 (58%), Gaps = 3/256 (1%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+ LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +D++       D +
Sbjct: 1   MGRMLIEAVLAAPDATLAGALDRTGSPQLGQDAGAFLG-KQTGVALTDDIERVCAEADYL 59

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF+ P  TL  L+ + +H++  +IGTTGFS  +   + +      +V S+NMS+G+N  
Sbjct: 60  IDFTRPEGTLAHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGGKIALVFSANMSVGVNVT 119

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L+E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA      L D  V  R
Sbjct: 120 MKLLEFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATGRTLDDCAVYGR 177

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
           H     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +A+G+L AA + 
Sbjct: 178 HGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSYAQGALRAARFL 237

Query: 256 KSQIPGLYSMRDVLGI 271
                G + M+DVLG+
Sbjct: 238 AGHQAGFFDMQDVLGL 253


>gi|145298637|ref|YP_001141478.1| dihydrodipicolinate reductase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|229627861|sp|A4SLF8|DAPB_AERS4 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|142851409|gb|ABO89730.1| dihydrodipicolinate reductase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 270

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 3   QSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
            +P+R++V+G  GRMG+ L++ I N   + + + + R GS +IG D G   G+  +G+  
Sbjct: 2   DNPIRVAVMGCNGRMGKVLLEAITNADGVVVGAALERPGSAVIGLDAGELNGLGKLGVMI 61

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           SD+L       D IIDF+ P +TL +L  +  H    +IGTTGF       +    +   
Sbjct: 62  SDSLDKVRDEFDLIIDFTRPEVTLANLAFALAHQKQMVIGTTGFDDAGKAALKEAGKQIG 121

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIA 180
           IV +SN S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE +A
Sbjct: 122 IVFASNYSVGVNLVFKLLEQAAKVM---GDYTDIEIIEGHHRHKVDAPSGTALSMGEVVA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
                +L +  V  R      R   +IG A++RAG +VGEH+V+ A  GE + +SH A  
Sbjct: 179 KTLGRDLKECAVYGREGITGERDRNTIGFATIRAGDMVGEHTVMFADIGERVEISHKASS 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVL 269
           R  FA G++ A  W   Q  GLY M+DVL
Sbjct: 239 RLTFANGAVRAGKWLGQQGAGLYDMQDVL 267


>gi|238752265|ref|ZP_04613745.1| Dihydrodipicolinate reductase [Yersinia rohdei ATCC 43380]
 gi|238709533|gb|EEQ01771.1| Dihydrodipicolinate reductase [Yersinia rohdei ATCC 43380]
          Length = 273

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 161/273 (58%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S +RI+++G GGRMG+ LI+ I     + L + + R+GS L+G D G   G   + I
Sbjct: 1   MTDSIIRIAIVGAGGRMGRQLIQAITQTKGVVLGAAVERAGSSLVGCDAGELAGTGLLDI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
             SD+L+      D +IDF+ P  TL+ L I  +H    +IGTTGF       IS+ A +
Sbjct: 61  TVSDDLSKVTDHFDVLIDFTRPEGTLEHLAICRKHCKAMVIGTTGFDDAGKAAISAAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE 
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEV 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IADSLGRSLKDCAVYSREGYTGERKPGTIGFATVRAGDIVGEHTAMFADIGERVEITHIA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A+W      GL+ MRDVL +
Sbjct: 238 TSRMTFANGAVKSAVWVSKLDNGLFDMRDVLSL 270


>gi|218660782|ref|ZP_03516712.1| putative dihydrodipicolinate reductase [Rhizobium etli IE4771]
          Length = 256

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 116/270 (42%), Positives = 153/270 (56%), Gaps = 19/270 (7%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++++V G  GRMG+A++  +  +P  T    I R G+                G    
Sbjct: 3   TPIKVAVAGANGRMGRAILPLLAADPDFTFVGGIGRDGA---------------AGAGLI 47

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHN-IVHIIGTTGFSVKENEVISSFARNAP 121
           D  A A+ + D I+DFS+ A   +   + A       +IG TGF   E E I++ AR  P
Sbjct: 48  DRSA-AMAAADVILDFSTGAAAAELAGLCAAAGGPALVIGATGFEPDELERIAAAARTIP 106

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           I++S N S+G+N L  LV  AA  L PA  WD EILE HH +K+D+PSGTAL+LGEA A 
Sbjct: 107 ILRSGNFSIGVNMLVGLVTQAARAL-PAHGWDIEILEAHHNKKIDAPSGTALMLGEAAAE 165

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR V+L       R      R  G IG A LRAG +VGEH V+ A   E +TLSHSA DR
Sbjct: 166 GRGVSLASVERRGRDGITGERPPGEIGFAVLRAGGLVGEHKVLFAAAEEVLTLSHSALDR 225

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +FARG+L AA W   + PG Y+MRDVLG+
Sbjct: 226 GMFARGALAAARWIAGRAPGEYNMRDVLGL 255


>gi|300948632|ref|ZP_07162716.1| dihydrodipicolinate reductase [Escherichia coli MS 116-1]
 gi|300956958|ref|ZP_07169210.1| dihydrodipicolinate reductase [Escherichia coli MS 175-1]
 gi|301024774|ref|ZP_07188412.1| dihydrodipicolinate reductase [Escherichia coli MS 196-1]
 gi|331650920|ref|ZP_08351948.1| dihydrodipicolinate reductase [Escherichia coli M718]
 gi|299880264|gb|EFI88475.1| dihydrodipicolinate reductase [Escherichia coli MS 196-1]
 gi|300316248|gb|EFJ66032.1| dihydrodipicolinate reductase [Escherichia coli MS 175-1]
 gi|300451858|gb|EFK15478.1| dihydrodipicolinate reductase [Escherichia coli MS 116-1]
 gi|323939750|gb|EGB35952.1| dihydrodipicolinate reductase [Escherichia coli E482]
 gi|331051374|gb|EGI23423.1| dihydrodipicolinate reductase [Escherichia coli M718]
          Length = 273

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  GSIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGSIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|256025348|ref|ZP_05439213.1| dihydrodipicolinate reductase [Escherichia sp. 4_1_40B]
          Length = 273

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 154/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L    +  D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKEDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|293392270|ref|ZP_06636604.1| dihydrodipicolinate reductase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952804|gb|EFE02923.1| dihydrodipicolinate reductase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 270

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I+V+G GGRMG+ LI+ +HN   + L +   R GS L+G D G   GI  +GIK  D
Sbjct: 2   TLKIAVVGAGGRMGRQLIQAVHNAEGVELGAAFERKGSSLVGADAGELAGIGNLGIKVGD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L  A    D +IDF+    TL+ L     +    +IGTTGF       I S A    IV
Sbjct: 62  DLDAAKDRFDLLIDFTRSEGTLEHLAFCVANRKKIVIGTTGFDDTGKAAIKSAAEKTAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKTHGVFCRDGIIGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W + +  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLEGKNNGLFDMTDVL 265


>gi|291616226|ref|YP_003518968.1| DapB [Pantoea ananatis LMG 20103]
 gi|291151256|gb|ADD75840.1| DapB [Pantoea ananatis LMG 20103]
          Length = 271

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 155/266 (58%), Gaps = 5/266 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI+++G  GRMG+ LI+ +     + L + + R GS LIG D G   GI   G+   D+
Sbjct: 4   IRIAIVGAPGRMGRNLIQAVAQLEGVELGAALARPGSSLIGSDAGELAGIGHAGVTLRDD 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+ P  TL+ L I  +H    IIGTTGF+      I   A +  IV 
Sbjct: 64  LRAVVDDFDVVIDFTRPEGTLEYLAICREHRKAMIIGTTGFNEAGKAAIRDAAADIGIVF 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEAIA   
Sbjct: 124 AANFSVGVNLVLKLLEKAAKVM---GDYADIEIIEAHHRHKVDAPSGTALAMGEAIAEAM 180

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
              L +H V +R      R   +IG A++RAG IVGEH+ + A EGE I ++H A  R  
Sbjct: 181 DWKLDEHAVYSREGHTGERKANTIGFATVRAGDIVGEHTALFADEGERIEITHKASSRMT 240

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA+W      GLY MRDVL
Sbjct: 241 FANGAVKAAIWVSENKTGLYDMRDVL 266


>gi|88857848|ref|ZP_01132490.1| dihydrodipicolinate reductase [Pseudoalteromonas tunicata D2]
 gi|88819465|gb|EAR29278.1| dihydrodipicolinate reductase [Pseudoalteromonas tunicata D2]
          Length = 267

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 153/266 (57%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI V G  GRMGQAL++  + + +  + +  VR  S   G +VG  +G++ +   F    
Sbjct: 3   RIGVFGANGRMGQALLQATYQDNNSEIAAAYVRKTSDFFGINVGPIIGVNDIEQTFCALE 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
                +VD +IDF+ P   L  L  +  + I  +IGTTG + +E   +   A+  PIV S
Sbjct: 63  QTNCTNVDVLIDFTLPQGMLVHLAYAVANQIPMVIGTTGLTAEEFAKLQQAAKTIPIVFS 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            N S+GIN L  LV+TAA+ L  + + D EI E HHR K+D+PSGTAL +GEAIA  +  
Sbjct: 123 RNFSVGINLLLNLVQTAAKTL--SDEIDIEIFEAHHRHKIDAPSGTALAIGEAIAEAKGW 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +  +     RH    A+++  IG + LRAG IVGEH+   A  GE + ++H A  R  FA
Sbjct: 181 DHNEVARYERHQDHVAKSQNEIGYSVLRAGDIVGEHTAYFASIGERLEITHKASSRMTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA W K++  GLY M+DVLG 
Sbjct: 241 QGAVRAAGWLKNKPAGLYDMQDVLGF 266


>gi|307249890|ref|ZP_07531864.1| hypothetical protein appser4_6880 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858079|gb|EFM90161.1| hypothetical protein appser4_6880 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 269

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 148/266 (55%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLNQNTH-FDVLIDFTRPEGTLEHIKCCVANGKKMVIGTTGFDDAGKQAIQAAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGIIGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|302879357|ref|YP_003847921.1| dihydrodipicolinate reductase [Gallionella capsiferriformans ES-2]
 gi|302582146|gb|ADL56157.1| dihydrodipicolinate reductase [Gallionella capsiferriformans ES-2]
          Length = 268

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 161/267 (60%), Gaps = 4/267 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + ++I++ G  GRMG+ L+  +     + LH+ +  +GS L+G+D G   G +P G+K S
Sbjct: 2   NKIKIAIAGSSGRMGRVLLDCVAAADDLVLHAALEHAGSTLLGRDAGELSG-APCGVKIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            ++  A+   D +IDF+ P  TL  L I  +  +  +IGTTGF+ ++   + + A++  I
Sbjct: 61  ADVEAALAGADVLIDFTRPEGTLDHLAICRRLGVNMVIGTTGFNAQQKAQLGAGAQDVGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N +  L+ETA   L  ++ +D EI+E HHR K+D+PSGTAL LGE +A  
Sbjct: 121 VFAPNMSVGVNLVFKLLETATRVL--SEGYDIEIIEAHHRHKVDAPSGTALGLGEVVART 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L++  V  R      R   +IG A++R G IVG+H+V+ AG GE I ++H A  R 
Sbjct: 179 LGRDLSECAVYGREGVTGERDPSTIGFATVRGGDIVGDHTVLYAGIGERIEITHKASSRA 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVL 269
            FA G+L AA + K    G+Y M+DVL
Sbjct: 239 TFALGALRAARFLKVNPAGMYDMQDVL 265


>gi|27904639|ref|NP_777765.1| dihydrodipicolinate reductase [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
 gi|29427649|sp|P59474|DAPB_BUCBP RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|27904036|gb|AAO26870.1| dihydrodipicolinate reductase [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 272

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 168/276 (60%), Gaps = 9/276 (3%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M ++ + I++ G  G+MG  LI EI++  ++ L + IV++ SP + ++VG    I  + I
Sbjct: 1   MKKTTLNIAISGALGKMGINLIHEIYHTKNVFLTAAIVKNNSPYVQKNVGKITKIGEINI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISA--QHNIVHIIGTTGFSVKENEVISSFA 117
             +++L   I   D +IDF++P  TL++L I A  + NI  IIGTTGF+ +E + I   +
Sbjct: 61  PITNSLEENINKFDILIDFTNPKTTLKNLEICAVAKKNI--IIGTTGFTQEEQKKIKLLS 118

Query: 118 RNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGE 177
           +   IV+SSN S+GIN +  L+E   + +   K+ D EI+E HH +K+D+PSGT+L +G+
Sbjct: 119 KKIGIVQSSNYSIGINLMISLLEKTTQII--GKNTDIEIIEAHHNKKIDAPSGTSLEIGK 176

Query: 178 AIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHS 237
            I      + +   +  RH    +R    IG +S+RAG+IVGEH V+ A  GE I ++H 
Sbjct: 177 KICKTMNWDFSKQAIYERHSSMKSRANNEIGFSSIRAGNIVGEHKVLFANSGEHIEITHK 236

Query: 238 AYDRRIFARGSLTAALW--AKSQIPGLYSMRDVLGI 271
           A  R IF++G++ AA+W  +K+   GL++M  +L I
Sbjct: 237 AISRSIFSKGAIQAAIWLFSKNYKNGLFNMNHILNI 272


>gi|331671549|ref|ZP_08372347.1| dihydrodipicolinate reductase [Escherichia coli TA280]
 gi|331071394|gb|EGI42751.1| dihydrodipicolinate reductase [Escherichia coli TA280]
          Length = 273

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVV---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  GSIG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGSIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|74317143|ref|YP_314883.1| dihydrodipicolinate reductase [Thiobacillus denitrificans ATCC
           25259]
 gi|90101265|sp|Q3SJS2|DAPB_THIDA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|74056638|gb|AAZ97078.1| dihydrodipicolinate reductase [Thiobacillus denitrificans ATCC
           25259]
          Length = 267

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 155/267 (58%), Gaps = 4/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G  GRMG+AL++ +  +    L++ + R GS L+GQD G   G +   +  +D 
Sbjct: 3   VRVAIAGVSGRMGRALLEAVAADDGCALYAALDRPGSSLVGQDAGAAWGAANG-VTVTDQ 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A++    ++DF+ P  T   L   A   +  +IGTTGF       I++ A   P+V 
Sbjct: 62  AQAALKGAQVLVDFTRPEATFGYLEACALDGVPVVIGTTGFDEAGRARIAAAAERVPVVF 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N L  L E AAE L     +D EI+E HHR K+D+PSGTAL LG+A+A    
Sbjct: 122 APNMSVGVNLLMKLAEVAAEVL--QDGYDIEIIEAHHRHKVDAPSGTALGLGQAVARASG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R   +IG A++R G IVG+H+++ AG GE + L+H A  R  F
Sbjct: 180 RDLEACAVYGREGVTGERDPRTIGFATVRGGDIVGDHTLLFAGVGERVELTHKASSRATF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L AA W + + PGLY MRDVLG+
Sbjct: 240 AQGALRAAKWVQGRAPGLYDMRDVLGL 266


>gi|331645135|ref|ZP_08346246.1| dihydrodipicolinate reductase [Escherichia coli M605]
 gi|330909878|gb|EGH38388.1| dihydrodipicolinate reductase [Escherichia coli AA86]
 gi|331045892|gb|EGI18011.1| dihydrodipicolinate reductase [Escherichia coli M605]
          Length = 273

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCCQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|302035869|ref|YP_003796191.1| dihydrodipicolinate reductase [Candidatus Nitrospira defluvii]
 gi|300603933|emb|CBK40265.1| Dihydrodipicolinate reductase [Candidatus Nitrospira defluvii]
          Length = 267

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 147/258 (56%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG  L+  + ++  +TL   +   G   +G+D G   G    G+   D+L+  ++  +
Sbjct: 11  GRMGSRLVSLVKDSAFLTLAGAVEGKGHHAVGEDSGEVAGCGRTGVPIVDDLSSLMERGE 70

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            ++DF++PA TL  L I AQH    ++GTTGFS  E + + S ++  P V S NMS+G+N
Sbjct: 71  VVVDFTTPAATLGHLKIVAQHRRGIVVGTTGFSSSELDELRSVSKQIPCVFSPNMSVGVN 130

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            +  ++   A+ L   +D+D E++E HHR K D+PSGTAL + E +A     +L    V 
Sbjct: 131 VIYKVIAEMAKTL--GEDYDIEVIEAHHRLKKDAPSGTALKMAEVLARAVNRDLGQVGVY 188

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R  G IGI ++RAG IVG+H+V+    GE I L+H A  R  FARG+L AA 
Sbjct: 189 ARKGLIGERKRGEIGIQTIRAGDIVGDHTVMFGTMGERIELTHRASSRDTFARGALRAAR 248

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   Q PGLY M DVL +
Sbjct: 249 WVVKQPPGLYDMLDVLSL 266


>gi|323945768|gb|EGB41815.1| dihydrodipicolinate reductase [Escherichia coli H120]
          Length = 273

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLNGKKSGLFDMRDVL 268


>gi|225630214|ref|YP_002727005.1| dihydrodipicolinate reductase [Wolbachia sp. wRi]
 gi|254767071|sp|C0R2S2|DAPB_WOLWR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|225592195|gb|ACN95214.1| dihydrodipicolinate reductase [Wolbachia sp. wRi]
          Length = 261

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/268 (39%), Positives = 156/268 (58%), Gaps = 13/268 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+ V+G  GRMG+ ++ E+  N  + +   + RSGS  I  D+G    I+ +GIK + +
Sbjct: 3   IRVGVIGCLGRMGKKILNELITNTKVEIAGAVARSGSKYIDSDIGPI--IANLGIKVTSS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           ++   +S D +IDF++    L  L  + +     + GTTG    E   +  +A   PI+ 
Sbjct: 61  ISDVFESSDVVIDFTTKECMLDCLKAAVKFKTPLVSGTTGI---EGVDLKEYAAEVPILW 117

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N L  LV+ AAE L    ++D EI EMHH  K DSPSGTA+ LG+ IAN  K
Sbjct: 118 SANMSVGVNVLLKLVKKAAELL--GNEYDVEIWEMHHNLKKDSPSGTAIELGKTIANASK 175

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V+   +  L  H     R +G IG A  R G ++G+HSV+     E I L+H A DR  F
Sbjct: 176 VDFQSNQYL--HSGSNIRKKGGIGFAVSRGGGVIGDHSVMFVNSDERIELNHKAIDRTTF 233

Query: 245 ARGSLTAALWA---KSQIPGLYSMRDVL 269
           ARG++ AA+W    K +IPGLYSM+DV+
Sbjct: 234 ARGAVQAAVWLYENKREIPGLYSMQDVI 261


>gi|82542647|ref|YP_406594.1| dihydrodipicolinate reductase [Shigella boydii Sb227]
 gi|90101258|sp|Q326J2|DAPB_SHIBS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|81244058|gb|ABB64766.1| dihydrodipicolinate reductase [Shigella boydii Sb227]
          Length = 273

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSRESHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|301019787|ref|ZP_07183931.1| dihydrodipicolinate reductase [Escherichia coli MS 69-1]
 gi|300399074|gb|EFJ82612.1| dihydrodipicolinate reductase [Escherichia coli MS 69-1]
          Length = 273

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 154/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL+ L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLKHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|109898533|ref|YP_661788.1| dihydrodipicolinate reductase [Pseudoalteromonas atlantica T6c]
 gi|123360773|sp|Q15TQ4|DAPB_PSEA6 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|109700814|gb|ABG40734.1| dihydrodipicolinate reductase [Pseudoalteromonas atlantica T6c]
          Length = 267

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 156/266 (58%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I++ G  GRMG+ LI+ I  + + TL++  VR+ S ++G DVG   GI   G+  +D  
Sbjct: 3   KIAIFGANGRMGRVLIEAIDQSQNATLNAAFVRASSSMMGVDVGELAGIGQRGLTVTDAN 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           +     +D +IDF+ P     +L +  Q     +IGTTG + ++ + +   +++ PIV +
Sbjct: 63  SADFSQIDIVIDFTLPEALEANLALCVQQKKPVVIGTTGLNQQQKDALQRASQHIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N L  L    A  +      D EI+E HHR K D+PSGTA+ +GE IA+    
Sbjct: 123 ANYSIGVNLLLNLARQTARVM--GGTADIEIIEGHHRFKKDAPSGTAVAIGEVIADELGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L+   V  R      R + +IG A++RAG IVGEH+ + A  GE I L+H A  R  FA
Sbjct: 181 DLSTCAVYGREGDTGERDQQTIGFATVRAGDIVGEHTALFADIGERIELTHKASSRLTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
            G++ AA+W K++ PGLY M+DVLG+
Sbjct: 241 NGAVKAAVWLKNKSPGLYDMQDVLGL 266


>gi|16128025|ref|NP_414572.1| dihydrodipicolinate reductase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89106915|ref|AP_000695.1| dihydrodipicolinate reductase [Escherichia coli str. K-12 substr.
           W3110]
 gi|170021611|ref|YP_001726565.1| dihydrodipicolinate reductase [Escherichia coli ATCC 8739]
 gi|170079694|ref|YP_001729014.1| dihydrodipicolinate reductase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|218703291|ref|YP_002410810.1| dihydrodipicolinate reductase [Escherichia coli UMN026]
 gi|238899436|ref|YP_002925232.1| dihydrodipicolinate reductase [Escherichia coli BW2952]
 gi|293403104|ref|ZP_06647201.1| dihydrodipicolinate reductase [Escherichia coli FVEC1412]
 gi|293408122|ref|ZP_06651962.1| dihydrodipicolinate reductase [Escherichia coli B354]
 gi|298378631|ref|ZP_06988515.1| dihydrodipicolinate reductase [Escherichia coli FVEC1302]
 gi|300900951|ref|ZP_07119085.1| dihydrodipicolinate reductase [Escherichia coli MS 198-1]
 gi|301648405|ref|ZP_07248141.1| dihydrodipicolinate reductase [Escherichia coli MS 146-1]
 gi|307136633|ref|ZP_07495989.1| dihydrodipicolinate reductase [Escherichia coli H736]
 gi|312970123|ref|ZP_07784305.1| dihydrodipicolinate reductase [Escherichia coli 1827-70]
 gi|331640478|ref|ZP_08341626.1| dihydrodipicolinate reductase [Escherichia coli H736]
 gi|331661395|ref|ZP_08362319.1| dihydrodipicolinate reductase [Escherichia coli TA143]
 gi|118242|sp|P04036|DAPB_ECOLI RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|189082795|sp|B1IRE5|DAPB_ECOLC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226724140|sp|B7N7Q5|DAPB_ECOLU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|229627864|sp|B1XBF6|DAPB_ECODH RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|259586130|sp|C4ZPV7|DAPB_ECOBW RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|3891980|pdb|1ARZ|A Chain A, Escherichia Coli Dihydrodipicolinate Reductase In Complex
           With Nadh And 2,6 Pyridine Dicarboxylate
 gi|3891981|pdb|1ARZ|B Chain B, Escherichia Coli Dihydrodipicolinate Reductase In Complex
           With Nadh And 2,6 Pyridine Dicarboxylate
 gi|3891982|pdb|1ARZ|C Chain C, Escherichia Coli Dihydrodipicolinate Reductase In Complex
           With Nadh And 2,6 Pyridine Dicarboxylate
 gi|3891983|pdb|1ARZ|D Chain D, Escherichia Coli Dihydrodipicolinate Reductase In Complex
           With Nadh And 2,6 Pyridine Dicarboxylate
 gi|157830822|pdb|1DIH|A Chain A, Three-Dimensional Structure Of E. Coli Dihydrodipicolinate
           Reductase
 gi|157830878|pdb|1DRU|A Chain A, Escherichia Coli DhprNADH COMPLEX
 gi|157830879|pdb|1DRV|A Chain A, Escherichia Coli DhprACNADH COMPLEX
 gi|157830880|pdb|1DRW|A Chain A, Escherichia Coli DhprNHDH COMPLEX
 gi|145710|gb|AAA23666.1| dihydropicolinate reductase [Escherichia coli]
 gi|1786214|gb|AAC73142.1| dihydrodipicolinate reductase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|21321913|dbj|BAB96600.1| dihydrodipicolinate reductase [Escherichia coli str. K12 substr.
           W3110]
 gi|169756539|gb|ACA79238.1| Dihydrodipicolinate reductase [Escherichia coli ATCC 8739]
 gi|169887529|gb|ACB01236.1| dihydrodipicolinate reductase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|218430388|emb|CAR11255.1| dihydrodipicolinate reductase [Escherichia coli UMN026]
 gi|238860760|gb|ACR62758.1| dihydrodipicolinate reductase [Escherichia coli BW2952]
 gi|260450760|gb|ACX41182.1| Dihydrodipicolinate reductase [Escherichia coli DH1]
 gi|291430019|gb|EFF03033.1| dihydrodipicolinate reductase [Escherichia coli FVEC1412]
 gi|291472373|gb|EFF14855.1| dihydrodipicolinate reductase [Escherichia coli B354]
 gi|298280965|gb|EFI22466.1| dihydrodipicolinate reductase [Escherichia coli FVEC1302]
 gi|300355578|gb|EFJ71448.1| dihydrodipicolinate reductase [Escherichia coli MS 198-1]
 gi|301073540|gb|EFK88346.1| dihydrodipicolinate reductase [Escherichia coli MS 146-1]
 gi|310337621|gb|EFQ02732.1| dihydrodipicolinate reductase [Escherichia coli 1827-70]
 gi|315134725|dbj|BAJ41884.1| dihydrodipicolinate reductase [Escherichia coli DH1]
 gi|315616194|gb|EFU96813.1| dihydrodipicolinate reductase [Escherichia coli 3431]
 gi|331040224|gb|EGI12431.1| dihydrodipicolinate reductase [Escherichia coli H736]
 gi|331061310|gb|EGI33273.1| dihydrodipicolinate reductase [Escherichia coli TA143]
 gi|332341361|gb|AEE54695.1| dihydrodipicolinate reductase DapB [Escherichia coli UMNK88]
          Length = 273

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|254037446|ref|ZP_04871523.1| dihydrodipicolinate reductase [Escherichia sp. 1_1_43]
 gi|226840552|gb|EEH72554.1| dihydrodipicolinate reductase [Escherichia sp. 1_1_43]
          Length = 273

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 154/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW   +  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVLNL 270


>gi|254805755|ref|YP_003083976.1| Dihydrodipicolinate reductase [Neisseria meningitidis alpha14]
 gi|254669297|emb|CBA08272.1| Dihydrodipicolinate reductase [Neisseria meningitidis alpha14]
          Length = 269

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKGVCIIIGTTGFDDTGKAAIRTAAEQTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|157156976|ref|YP_001461199.1| dihydrodipicolinate reductase [Escherichia coli E24377A]
 gi|157159498|ref|YP_001456816.1| dihydrodipicolinate reductase [Escherichia coli HS]
 gi|191168891|ref|ZP_03030662.1| dihydrodipicolinate reductase [Escherichia coli B7A]
 gi|193066209|ref|ZP_03047262.1| dihydrodipicolinate reductase [Escherichia coli E22]
 gi|193070975|ref|ZP_03051904.1| dihydrodipicolinate reductase [Escherichia coli E110019]
 gi|194429872|ref|ZP_03062384.1| dihydrodipicolinate reductase [Escherichia coli B171]
 gi|209917220|ref|YP_002291304.1| dihydrodipicolinate reductase [Escherichia coli SE11]
 gi|218552615|ref|YP_002385528.1| dihydrodipicolinate reductase [Escherichia coli IAI1]
 gi|218693502|ref|YP_002401169.1| dihydrodipicolinate reductase [Escherichia coli 55989]
 gi|256020129|ref|ZP_05433994.1| dihydrodipicolinate reductase [Shigella sp. D9]
 gi|260842268|ref|YP_003220046.1| dihydrodipicolinate reductase [Escherichia coli O103:H2 str. 12009]
 gi|260853241|ref|YP_003227132.1| dihydrodipicolinate reductase [Escherichia coli O26:H11 str. 11368]
 gi|260866181|ref|YP_003232583.1| dihydrodipicolinate reductase [Escherichia coli O111:H- str. 11128]
 gi|293476693|ref|ZP_06665101.1| dihydrodipicolinate reductase [Escherichia coli B088]
 gi|300816063|ref|ZP_07096286.1| dihydrodipicolinate reductase [Escherichia coli MS 107-1]
 gi|300821967|ref|ZP_07102111.1| dihydrodipicolinate reductase [Escherichia coli MS 119-7]
 gi|300905431|ref|ZP_07123198.1| dihydrodipicolinate reductase [Escherichia coli MS 84-1]
 gi|309797796|ref|ZP_07692180.1| dihydrodipicolinate reductase [Escherichia coli MS 145-7]
 gi|331680599|ref|ZP_08381258.1| dihydrodipicolinate reductase [Escherichia coli H591]
 gi|332281284|ref|ZP_08393697.1| dihydrodipicolinate reductase [Shigella sp. D9]
 gi|167012018|sp|A7ZHC0|DAPB_ECO24 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|167012019|sp|A7ZVX9|DAPB_ECOHS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226696352|sp|B6HYX9|DAPB_ECOSE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226724139|sp|B7M0C7|DAPB_ECO8A RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|254767047|sp|B7L4F3|DAPB_ECO55 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|157065178|gb|ABV04433.1| dihydrodipicolinate reductase [Escherichia coli HS]
 gi|157079006|gb|ABV18714.1| dihydrodipicolinate reductase [Escherichia coli E24377A]
 gi|190901057|gb|EDV60835.1| dihydrodipicolinate reductase [Escherichia coli B7A]
 gi|192926134|gb|EDV80775.1| dihydrodipicolinate reductase [Escherichia coli E22]
 gi|192955705|gb|EDV86179.1| dihydrodipicolinate reductase [Escherichia coli E110019]
 gi|194412091|gb|EDX28401.1| dihydrodipicolinate reductase [Escherichia coli B171]
 gi|209910479|dbj|BAG75553.1| dihydrodipicolinate reductase [Escherichia coli SE11]
 gi|218350234|emb|CAU95917.1| dihydrodipicolinate reductase [Escherichia coli 55989]
 gi|218359383|emb|CAQ96922.1| dihydrodipicolinate reductase [Escherichia coli IAI1]
 gi|257751890|dbj|BAI23392.1| dihydrodipicolinate reductase [Escherichia coli O26:H11 str. 11368]
 gi|257757415|dbj|BAI28912.1| dihydrodipicolinate reductase [Escherichia coli O103:H2 str. 12009]
 gi|257762537|dbj|BAI34032.1| dihydrodipicolinate reductase [Escherichia coli O111:H- str. 11128]
 gi|291321146|gb|EFE60588.1| dihydrodipicolinate reductase [Escherichia coli B088]
 gi|300402709|gb|EFJ86247.1| dihydrodipicolinate reductase [Escherichia coli MS 84-1]
 gi|300525567|gb|EFK46636.1| dihydrodipicolinate reductase [Escherichia coli MS 119-7]
 gi|300531270|gb|EFK52332.1| dihydrodipicolinate reductase [Escherichia coli MS 107-1]
 gi|308118625|gb|EFO55887.1| dihydrodipicolinate reductase [Escherichia coli MS 145-7]
 gi|315255697|gb|EFU35665.1| dihydrodipicolinate reductase [Escherichia coli MS 85-1]
 gi|323157913|gb|EFZ44016.1| dihydrodipicolinate reductase [Escherichia coli EPECa14]
 gi|323160053|gb|EFZ46016.1| dihydrodipicolinate reductase [Escherichia coli E128010]
 gi|323171449|gb|EFZ57096.1| dihydrodipicolinate reductase [Escherichia coli LT-68]
 gi|323176336|gb|EFZ61928.1| dihydrodipicolinate reductase [Escherichia coli 1180]
 gi|323181725|gb|EFZ67138.1| dihydrodipicolinate reductase [Escherichia coli 1357]
 gi|324017704|gb|EGB86923.1| dihydrodipicolinate reductase [Escherichia coli MS 117-3]
 gi|331072062|gb|EGI43398.1| dihydrodipicolinate reductase [Escherichia coli H591]
 gi|332103636|gb|EGJ06982.1| dihydrodipicolinate reductase [Shigella sp. D9]
          Length = 273

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|117559644|gb|ABK36592.1| dihydrodipicolinate reductase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 297

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 159/271 (58%), Gaps = 5/271 (1%)

Query: 3   QSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
            +P+R++V+G  GRMG+ L++ I +   + + + + R GS +IG D G   G+  +G+  
Sbjct: 29  DNPIRVAVMGCNGRMGKVLLEAISHAEGVVVGAALERPGSAVIGLDAGELNGLGRLGVII 88

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           SD+L       D IIDF+ P +TL +L  +  H+   +IGTTGF       + + A    
Sbjct: 89  SDSLDKVRDEFDLIIDFTRPEVTLANLAFARAHHKQMVIGTTGFDDAGKAALKAAAGEIG 148

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIA 180
           IV +SN S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE +A
Sbjct: 149 IVFASNYSVGVNLVFKLLEQAAKVM---GDYTDIEIIEGHHRHKVDAPSGTALSMGEVVA 205

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
                +L +  V  R      R   +IG A++RAG +VGEH+V+ A  GE + +SH A  
Sbjct: 206 KTLGRDLKECAVYGREGITGERDRNTIGFATIRAGDLVGEHTVMFADIGERVEISHKASS 265

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R  FA G++ A  W K Q  GLY M+DVLG+
Sbjct: 266 RLTFANGAVRAGKWLKGQGAGLYDMQDVLGL 296


>gi|288941568|ref|YP_003443808.1| dihydrodipicolinate reductase [Allochromatium vinosum DSM 180]
 gi|288896940|gb|ADC62776.1| dihydrodipicolinate reductase [Allochromatium vinosum DSM 180]
          Length = 272

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 152/269 (56%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +RI++ G GGRMG+ LI+ +     + L +   R+GS LIG D G   G+  + +   
Sbjct: 2   SEIRIAIAGAGGRMGRTLIQAVVEAEGLKLGAATERAGSSLIGSDAGELAGVGRLDVAVV 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
             LA  +   D +IDF+SPA T+  L +  +     +IGTTG    +   I S   +  I
Sbjct: 62  VELASVLDDFDVLIDFTSPAATMDHLALCREAGKRMVIGTTGLDETQRAAIESAGADIGI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L++ AA  L    + D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 122 VFAPNMSVGVNLCFKLLDIAARVL--GDEVDIEIIEAHHRHKVDAPSGTALGMGEVIAKA 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R  Q  AR   +IG  ++RAG +VGEH+V  A +GE + ++H A +R 
Sbjct: 180 LGRDLKEVAVYGREGQTGARERRTIGFETIRAGDVVGEHTVWFAADGERVEIAHKASNRM 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA W   +  G + M+DVLG+
Sbjct: 240 TFAGGAVRAARWIAGRERGRFDMQDVLGL 268


>gi|332306408|ref|YP_004434259.1| dihydrodipicolinate reductase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173737|gb|AEE22991.1| dihydrodipicolinate reductase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 267

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/266 (38%), Positives = 153/266 (57%), Gaps = 3/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I++ G  GRMG+ LI  +    + TL +  VR+ S ++G DVG   GI   G+  SD  
Sbjct: 3   KIAIFGANGRMGRVLIDALDQAQNATLCAAYVRASSSMMGVDVGELAGIGQRGLTVSDAN 62

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           +   +  D +IDF+ P     +L +   HN   +IGTTG + ++ E +   +++ PIV +
Sbjct: 63  SGDFKQTDILIDFTLPEALEANLALCVTHNKPIVIGTTGLNQQQKEALQQASQHIPIVFA 122

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N L  L    A  +      D EI+E HHR K D+PSGTA+ +GEAIA+    
Sbjct: 123 ANYSVGVNLLLNLARQTARVM--GDTADIEIIEGHHRFKKDAPSGTAVAIGEAIADELGR 180

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R      R + +IG A++RAG IVGEH+ + A  GE I L+H A  R  FA
Sbjct: 181 DLATCAVYGREGDTGERDQKTIGFATVRAGDIVGEHTTLFADIGERIELTHKASSRLTFA 240

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +G++ AA+W K +  GLY M+DVLG+
Sbjct: 241 KGAVKAAVWLKDKPAGLYDMQDVLGL 266


>gi|153869425|ref|ZP_01999024.1| Dihydrodipicolinate reductase [Beggiatoa sp. PS]
 gi|152074075|gb|EDN70972.1| Dihydrodipicolinate reductase [Beggiatoa sp. PS]
          Length = 287

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/260 (38%), Positives = 150/260 (57%), Gaps = 2/260 (0%)

Query: 12  GGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQS 71
             GRMG+ L++         L   +    S LIG D G   GI  + +   + L + I +
Sbjct: 29  AAGRMGRKLVEACTQETDTILTVALEHPESTLIGSDAGELAGIGKLDVSLVEQLDVVINN 88

Query: 72  VDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLG 131
           +D +I+F++P  TL  +      +   +IGTTGFS ++ ++I   A++  IV + NMS+G
Sbjct: 89  LDVLIEFTTPEATLAHVTTCRAAHKRMVIGTTGFSAEQRQIIEQAAQDIAIVFAPNMSVG 148

Query: 132 INFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHM 191
           +N    LVE AA+ L  + + D EI+E HHR K D+PSGTAL LGE +AN    NL++  
Sbjct: 149 VNLTFKLVEMAAKVL--SDNVDIEIIEAHHRHKADAPSGTALHLGEIVANTLGRNLSECA 206

Query: 192 VLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTA 251
           V  R  +   R+  +IG  ++RAG IVGEH+V+ A  GE I ++H A  R  FA+G++ A
Sbjct: 207 VYGRQGKTGERSPHTIGFETIRAGDIVGEHTVMFADIGERIEITHKASSRMTFAKGAIRA 266

Query: 252 ALWAKSQIPGLYSMRDVLGI 271
           A W   +  GL+ M+DVLG+
Sbjct: 267 AQWIMQKDKGLFDMQDVLGL 286


>gi|301156191|emb|CBW15662.1| dihydrodipicolinate reductase [Haemophilus parainfluenzae T3T1]
          Length = 270

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +HN     L +   R GS L+G D G   GI  +GIK SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHNAEGAELGAAFERKGSSLVGADAGELAGIGALGIKVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L     + + +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLNAEKDNFNLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDDAGKAAIQAASEKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W + Q  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLEKQSHGLFDMTDVL 265


>gi|323950481|gb|EGB46359.1| dihydrodipicolinate reductase [Escherichia coli H252]
          Length = 273

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKKSGLFDMRDVL 268


>gi|119503074|ref|ZP_01625159.1| Dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2080]
 gi|119461420|gb|EAW42510.1| Dihydrodipicolinate reductase [marine gamma proteobacterium
           HTCC2080]
          Length = 271

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 151/259 (58%), Gaps = 3/259 (1%)

Query: 14  GRMGQALIKEIHNNP-SITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSV 72
           GRMG+ L++ I  +  ++ L + I+R GS L G D G  +G +P G+ F++++ +A+  V
Sbjct: 12  GRMGRMLLEAIAASEYNVVLSAAILRPGSALCGVDTGTLLGGTPSGVLFTEDIKVAVNEV 71

Query: 73  DGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGI 132
           D ++DF+ P+  + +    A      + GTTGFS  + +      R   + ++SN S G+
Sbjct: 72  DVLVDFTPPSAAVLNAQYCAATGTPLVSGTTGFSATQVKQFHEATRAIALCQASNFSTGV 131

Query: 133 NFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMV 192
           N    L+  AA  L    + D EI E HHR K+D+PSGTA+ +GE +A     NL D  V
Sbjct: 132 NLAYRLLAQAAAIL--GSEADIEISEAHHRHKVDAPSGTAIAMGEVVAAATGRNLADVAV 189

Query: 193 LNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAA 252
             R      R   +IG +++RAG IVG+H+V  A +GE + ++H A  R  FARG++ AA
Sbjct: 190 YGREGLTGKRDRETIGFSTVRAGDIVGDHTVTFAAQGERLEITHKASSRMAFARGAIRAA 249

Query: 253 LWAKSQIPGLYSMRDVLGI 271
           +W  +Q PG+Y M+DVLG+
Sbjct: 250 VWLINQKPGVYDMQDVLGL 268


>gi|134095825|ref|YP_001100900.1| dihydrodipicolinate reductase [Herminiimonas arsenicoxydans]
 gi|167012021|sp|A4G8E2|DAPB_HERAR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|133739728|emb|CAL62779.1| Dihydrodipicolinate reductase (DHPR) [Herminiimonas arsenicoxydans]
          Length = 268

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/267 (41%), Positives = 155/267 (58%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I+V G  GRMG  LI+ I N    TL   +  + SP IG D   F+G  P G+    +
Sbjct: 4   MKIAVAGASGRMGHMLIEAILNAADATLSGALDIATSPAIGTDAAAFLG-KPSGVLIESD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  + + D +IDF+ P  TL+ L   A H I  IIGTTGF V     I++ A    I+ 
Sbjct: 63  LAKGLANADFLIDFTRPEGTLKHLEYCAAHGIKMIIGTTGFDVAGKAAIAAAAEKTAIMF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+    ++ +D EI+E HHR K+D+PSGTA+ +GE IA    
Sbjct: 123 APNMSVGVNVTMKLLEMAAQNF--SEGYDIEIIEAHHRNKVDAPSGTAIKMGEVIAGALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R     AR   SIG A++R G I+G+H+V+ AG+GE I +SH +  R  +
Sbjct: 181 KELNDVAVWAREGVTGARDPSSIGFATVRGGDIIGDHTVLFAGDGERIEISHKSSSRVSY 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A GSL AA +   +  GLY M+DVLG+
Sbjct: 241 AHGSLRAARFLADKKTGLYDMQDVLGL 267


>gi|296112276|ref|YP_003626214.1| dihydrodipicolinate reductase [Moraxella catarrhalis RH4]
 gi|295919970|gb|ADG60321.1| dihydrodipicolinate reductase [Moraxella catarrhalis RH4]
 gi|326560746|gb|EGE11114.1| dihydrodipicolinate reductase [Moraxella catarrhalis 46P47B1]
 gi|326562274|gb|EGE12600.1| dihydrodipicolinate reductase [Moraxella catarrhalis 103P14B1]
 gi|326564748|gb|EGE14961.1| dihydrodipicolinate reductase [Moraxella catarrhalis 12P80B1]
 gi|326568989|gb|EGE19058.1| dihydrodipicolinate reductase [Moraxella catarrhalis BC1]
 gi|326569289|gb|EGE19350.1| dihydrodipicolinate reductase [Moraxella catarrhalis BC7]
 gi|326571965|gb|EGE21970.1| dihydrodipicolinate reductase [Moraxella catarrhalis BC8]
 gi|326574526|gb|EGE24467.1| dihydrodipicolinate reductase [Moraxella catarrhalis CO72]
 gi|326575477|gb|EGE25402.1| dihydrodipicolinate reductase [Moraxella catarrhalis 101P30B1]
 gi|326577907|gb|EGE27771.1| dihydrodipicolinate reductase [Moraxella catarrhalis O35E]
          Length = 265

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 150/267 (56%), Gaps = 7/267 (2%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + ++I ++G  GRMG+ LI+   N+P+  L    VRS S LIG D G F+G    G+  S
Sbjct: 2   NKLKIGIMGASGRMGRMLIESTMNHPNTELGGAYVRSTSSLIGVDAGEFIGGKKSGVALS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
               +    VD +IDFS P    ++LN    H I  ++G TG S  +   +   A++  I
Sbjct: 62  ---TLDGSQVDVMIDFSLPEAFDEALNQCVTHKIPLVMGVTGLSDDQEAKLQDAAKHIAI 118

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + N S G+N    L+ T A  L    D D EI+E HH+ K+D+PSGTAL++ +AI   
Sbjct: 119 VYAGNYSTGVNLSLNLLATTARVL--GLDADVEIIEHHHKHKIDAPSGTALMMAQAITEA 176

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R  N+T+  +  R      R  G IGI +LR G IVGEH+V    +GE I ++H A +R 
Sbjct: 177 RGQNITNAAIYGRK-GAAKRQRGDIGIHALRGGEIVGEHTVEFMMDGEIIQITHKAQNRA 235

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVL 269
            FA G+L AALWA  Q  GLY M+DVL
Sbjct: 236 TFATGALRAALWAAQQPAGLYDMQDVL 262


>gi|229576676|ref|YP_857233.2| dihydrodipicolinate reductase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 270

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 159/271 (58%), Gaps = 5/271 (1%)

Query: 3   QSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
            +P+R++V+G  GRMG+ L++ I +   + + + + R GS +IG D G   G+  +G+  
Sbjct: 2   DNPIRVAVMGCNGRMGKVLLEAISHAEGVVVGAALERPGSAVIGLDAGELNGLGRLGVII 61

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           SD+L       D IIDF+ P +TL +L  +  H+   +IGTTGF       + + A    
Sbjct: 62  SDSLDKVRDEFDLIIDFTRPEVTLANLAFARAHHKQMVIGTTGFDDAGKAALKAAAGEIG 121

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIA 180
           IV +SN S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE +A
Sbjct: 122 IVFASNYSVGVNLVFKLLEQAAKVM---GDYTDIEIIEGHHRHKVDAPSGTALSMGEVVA 178

Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240
                +L +  V  R      R   +IG A++RAG +VGEH+V+ A  GE + +SH A  
Sbjct: 179 KTLGRDLKECAVYGREGITGERDRNTIGFATIRAGDLVGEHTVMFADIGERVEISHKASS 238

Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           R  FA G++ A  W K Q  GLY M+DVLG+
Sbjct: 239 RLTFANGAVRAGKWLKGQGAGLYDMQDVLGL 269


>gi|256823601|ref|YP_003147564.1| dihydrodipicolinate reductase [Kangiella koreensis DSM 16069]
 gi|256797140|gb|ACV27796.1| dihydrodipicolinate reductase [Kangiella koreensis DSM 16069]
          Length = 267

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/259 (40%), Positives = 156/259 (60%), Gaps = 5/259 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ L+K   ++  + +   + R+    +G D+G  VG+ P G+   D+L++ +    
Sbjct: 11  GRMGQELLKAAASDSQVEIVGAMARAQHQKLGTDIGYLVGMEPQGVFVGDDLSVTLNERK 70

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDFS P  ++++L+ +   N   +IGTTGFS ++ + I+  A++ PIV ++N SLG+N
Sbjct: 71  VLIDFSLPEHSIETLSHAVSANSPVVIGTTGFSDEQKQAITEAAQSIPIVFAANYSLGVN 130

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV+ A   L      D EI E HH+ K DSPSGTAL LGEA+A+ +  +L +    
Sbjct: 131 SLLGLVKQATRLL--GDKSDIEIFEAHHKYKKDSPSGTALALGEAVADTQGRDLDNVAEW 188

Query: 194 NRH-IQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAA 252
            RH I +  R  G+IG + +R G IVG H VV A +GE +TL H A  R+ FA+G++ AA
Sbjct: 189 ARHGIGE--REPGAIGFSVMRGGDIVGTHEVVFALKGELVTLRHEAQTRQCFAQGAIEAA 246

Query: 253 LWAKSQIPGLYSMRDVLGI 271
            W   +  GLY M+DVLG+
Sbjct: 247 KWLLGKPAGLYDMQDVLGL 265


>gi|315634382|ref|ZP_07889669.1| dihydrodipicolinate reductase [Aggregatibacter segnis ATCC 33393]
 gi|315476972|gb|EFU67717.1| dihydrodipicolinate reductase [Aggregatibacter segnis ATCC 33393]
          Length = 270

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 150/266 (56%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            +RI+++G GGRMG+ LI+ + N   + L +   R GS L+G D G   GI  +GI+  D
Sbjct: 2   ELRIAIVGAGGRMGRQLIQAVQNAEGVALGAAFERKGSSLVGADAGELAGIGNLGIQVGD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L  A +  D +IDF+ P  TL+ L     +    IIGTTGF       I + + +  +V
Sbjct: 62  DLNAAKEQFDVLIDFTRPEGTLEHLAFCVANQKNMIIGTTGFDDAGKAAIKAASEHIGVV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKTHGVFCRDGIIGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W + +  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLEGKDKGLFDMTDVL 265


>gi|163855857|ref|YP_001630155.1| dihydrodipicolinate reductase [Bordetella petrii DSM 12804]
 gi|163259585|emb|CAP41886.1| dapB [Bordetella petrii]
          Length = 263

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 151/267 (56%), Gaps = 5/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI++ G GGRMG+ LI+ + N+P + L   + R+GS   GQD G F+G    G+  +D 
Sbjct: 1   MRIAIAGAGGRMGRMLIEAVLNSPDLQLAVALCRAGSTAKGQDAGAFLG-RDTGVIVTDQ 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF+ P  TL  L    +H    +IGTTGF       I   A+   IV 
Sbjct: 60  LD-ALAQADCLIDFTRPDSTLHHLQACVRHGTRMVIGTTGFDDNGRAAIEVAAQKIAIVF 118

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA  L     +D E+ E HHR K+D+PSGTAL +GE +A+   
Sbjct: 119 APNMSVGVNATLKLLEVAARIL--NSGYDVEVFEAHHRNKVDAPSGTALKMGETVASAWN 176

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D     RH     R  G+IG + +R G IVG+H+V   G GE I ++H +  R  +
Sbjct: 177 VALPDVATWTRHGDTGVRKPGTIGFSVVRGGDIVGDHTVYFCGTGERIEITHRSSSRATY 236

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AA + + +  GL+ M+ VLG+
Sbjct: 237 AEGALRAARFLQGRHNGLFDMQAVLGL 263


>gi|24111477|ref|NP_705987.1| dihydrodipicolinate reductase [Shigella flexneri 2a str. 301]
 gi|26245952|ref|NP_751991.1| dihydrodipicolinate reductase [Escherichia coli CFT073]
 gi|30061599|ref|NP_835770.1| dihydrodipicolinate reductase [Shigella flexneri 2a str. 2457T]
 gi|91209089|ref|YP_539075.1| dihydrodipicolinate reductase [Escherichia coli UTI89]
 gi|110640242|ref|YP_667970.1| dihydrodipicolinate reductase [Escherichia coli 536]
 gi|117622321|ref|YP_851234.1| dihydrodipicolinate reductase [Escherichia coli APEC O1]
 gi|170682871|ref|YP_001742146.1| dihydrodipicolinate reductase [Escherichia coli SMS-3-5]
 gi|191174129|ref|ZP_03035643.1| dihydrodipicolinate reductase [Escherichia coli F11]
 gi|218556969|ref|YP_002389882.1| dihydrodipicolinate reductase [Escherichia coli S88]
 gi|218687906|ref|YP_002396118.1| dihydrodipicolinate reductase [Escherichia coli ED1a]
 gi|218698451|ref|YP_002406080.1| dihydrodipicolinate reductase [Escherichia coli IAI39]
 gi|227885073|ref|ZP_04002878.1| dihydrodipicolinate reductase [Escherichia coli 83972]
 gi|229774944|ref|YP_687618.2| dihydrodipicolinate reductase [Shigella flexneri 5 str. 8401]
 gi|237704171|ref|ZP_04534652.1| dihydrodipicolinate reductase [Escherichia sp. 3_2_53FAA]
 gi|300939441|ref|ZP_07154103.1| dihydrodipicolinate reductase [Escherichia coli MS 21-1]
 gi|300980962|ref|ZP_07175276.1| dihydrodipicolinate reductase [Escherichia coli MS 45-1]
 gi|300984132|ref|ZP_07176883.1| dihydrodipicolinate reductase [Escherichia coli MS 200-1]
 gi|301048411|ref|ZP_07195438.1| dihydrodipicolinate reductase [Escherichia coli MS 185-1]
 gi|306815371|ref|ZP_07449520.1| dihydrodipicolinate reductase [Escherichia coli NC101]
 gi|331661067|ref|ZP_08361999.1| dihydrodipicolinate reductase [Escherichia coli TA206]
 gi|331681412|ref|ZP_08382049.1| dihydrodipicolinate reductase [Escherichia coli H299]
 gi|34222582|sp|Q8FLB4|DAPB_ECOL6 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|39931104|sp|Q83SQ9|DAPB_SHIFL RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|122425072|sp|Q1RGH0|DAPB_ECOUT RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|123049526|sp|Q0TLW0|DAPB_ECOL5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|166222634|sp|A1A780|DAPB_ECOK1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226724137|sp|B7MAF2|DAPB_ECO45 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226724138|sp|B7NHD5|DAPB_ECO7I RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226724141|sp|B1LFW1|DAPB_ECOSM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|254767048|sp|B7MNN7|DAPB_ECO81 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|26106349|gb|AAN78535.1|AE016755_35 Dihydrodipicolinate reductase [Escherichia coli CFT073]
 gi|24050228|gb|AAN41694.1| dihydrodipicolinate reductase [Shigella flexneri 2a str. 301]
 gi|30039841|gb|AAP15575.1| dihydrodipicolinate reductase [Shigella flexneri 2a str. 2457T]
 gi|91070663|gb|ABE05544.1| dihydrodipicolinate reductase [Escherichia coli UTI89]
 gi|110341834|gb|ABG68071.1| dihydrodipicolinate reductase [Escherichia coli 536]
 gi|115511445|gb|ABI99519.1| dihydrodipicolinate reductase [Escherichia coli APEC O1]
 gi|170520589|gb|ACB18767.1| dihydrodipicolinate reductase [Escherichia coli SMS-3-5]
 gi|190905623|gb|EDV65248.1| dihydrodipicolinate reductase [Escherichia coli F11]
 gi|218363738|emb|CAR01398.1| dihydrodipicolinate reductase [Escherichia coli S88]
 gi|218368437|emb|CAR16173.1| dihydrodipicolinate reductase [Escherichia coli IAI39]
 gi|218425470|emb|CAR06252.1| dihydrodipicolinate reductase [Escherichia coli ED1a]
 gi|222031863|emb|CAP74601.1| Dihydrodipicolinate reductase [Escherichia coli LF82]
 gi|226902083|gb|EEH88342.1| dihydrodipicolinate reductase [Escherichia sp. 3_2_53FAA]
 gi|227837902|gb|EEJ48368.1| dihydrodipicolinate reductase [Escherichia coli 83972]
 gi|281177243|dbj|BAI53573.1| dihydrodipicolinate reductase [Escherichia coli SE15]
 gi|281599392|gb|ADA72376.1| Dihydrodipicolinate reductase [Shigella flexneri 2002017]
 gi|284919812|emb|CBG32867.1| dihydrodipicolinate reductase [Escherichia coli 042]
 gi|294489708|gb|ADE88464.1| dihydrodipicolinate reductase [Escherichia coli IHE3034]
 gi|300299704|gb|EFJ56089.1| dihydrodipicolinate reductase [Escherichia coli MS 185-1]
 gi|300306757|gb|EFJ61277.1| dihydrodipicolinate reductase [Escherichia coli MS 200-1]
 gi|300409119|gb|EFJ92657.1| dihydrodipicolinate reductase [Escherichia coli MS 45-1]
 gi|300455662|gb|EFK19155.1| dihydrodipicolinate reductase [Escherichia coli MS 21-1]
 gi|305851033|gb|EFM51488.1| dihydrodipicolinate reductase [Escherichia coli NC101]
 gi|307551874|gb|ADN44649.1| dihydrodipicolinate reductase [Escherichia coli ABU 83972]
 gi|307629603|gb|ADN73907.1| dihydrodipicolinate reductase [Escherichia coli UM146]
 gi|312944635|gb|ADR25462.1| dihydrodipicolinate reductase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|313646594|gb|EFS11055.1| dihydrodipicolinate reductase [Shigella flexneri 2a str. 2457T]
 gi|315285008|gb|EFU44453.1| dihydrodipicolinate reductase [Escherichia coli MS 110-3]
 gi|315293398|gb|EFU52750.1| dihydrodipicolinate reductase [Escherichia coli MS 153-1]
 gi|315298454|gb|EFU57709.1| dihydrodipicolinate reductase [Escherichia coli MS 16-3]
 gi|323955226|gb|EGB50999.1| dihydrodipicolinate reductase [Escherichia coli H263]
 gi|323964873|gb|EGB60340.1| dihydrodipicolinate reductase [Escherichia coli M863]
 gi|324008373|gb|EGB77592.1| dihydrodipicolinate reductase [Escherichia coli MS 57-2]
 gi|324012350|gb|EGB81569.1| dihydrodipicolinate reductase [Escherichia coli MS 60-1]
 gi|331052109|gb|EGI24148.1| dihydrodipicolinate reductase [Escherichia coli TA206]
 gi|331081633|gb|EGI52794.1| dihydrodipicolinate reductase [Escherichia coli H299]
 gi|332762317|gb|EGJ92584.1| dihydrodipicolinate reductase [Shigella flexneri 2747-71]
 gi|332762590|gb|EGJ92855.1| dihydrodipicolinate reductase [Shigella flexneri 4343-70]
 gi|332764872|gb|EGJ95100.1| dihydrodipicolinate reductase [Shigella flexneri K-671]
 gi|332768818|gb|EGJ98997.1| dihydrodipicolinate reductase [Shigella flexneri 2930-71]
 gi|333010522|gb|EGK29955.1| dihydrodipicolinate reductase [Shigella flexneri VA-6]
 gi|333022465|gb|EGK41703.1| dihydrodipicolinate reductase [Shigella flexneri K-304]
          Length = 273

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|323975802|gb|EGB70898.1| dihydrodipicolinate reductase [Escherichia coli TW10509]
          Length = 273

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 154/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW   +  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVLNL 270


>gi|74310649|ref|YP_309068.1| dihydrodipicolinate reductase [Shigella sonnei Ss046]
 gi|90101260|sp|Q3Z5X9|DAPB_SHISS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|73854126|gb|AAZ86833.1| dihydrodipicolinate reductase [Shigella sonnei Ss046]
 gi|323166076|gb|EFZ51855.1| dihydrodipicolinate reductase [Shigella sonnei 53G]
          Length = 273

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 154/273 (56%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW   +  GL+ MRDVL +
Sbjct: 238 SSRMTFANGAVRSALWLSGKENGLFDMRDVLNL 270


>gi|42520250|ref|NP_966165.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|81652715|sp|Q73I13|DAPB_WOLPM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|42409988|gb|AAS14099.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 261

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/268 (39%), Positives = 156/268 (58%), Gaps = 13/268 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+ V+G  GRMG+ ++ E+  N  + +   + RSGS  I  D+G    I+ +GIK + +
Sbjct: 3   IRVGVIGCLGRMGKKILNELITNTKVEIAGAVARSGSKYIDSDIGPI--IANLGIKVTSS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           ++   +S D +IDF++    L  L  + +     + GTTG    E   +  +A   PI+ 
Sbjct: 61  ISGIFESSDVVIDFTTKECMLDCLKAAVKFKTPLVSGTTGI---EGVDLKEYAAEVPILW 117

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N L  LV+ AAE L    ++D EI EMHH  K DSPSGTA+ LG+ IAN  K
Sbjct: 118 SANMSVGVNVLLKLVKKAAELL--GNEYDVEIWEMHHNLKKDSPSGTAIELGKTIANASK 175

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V+   +  L  H     R +G IG A  R G ++G+HSV+     E I L+H A DR  F
Sbjct: 176 VDFQSNQYL--HSGSNIRKKGGIGFAVSRGGGVIGDHSVMFVNSDERIELNHKAIDRTTF 233

Query: 245 ARGSLTAALWA---KSQIPGLYSMRDVL 269
           ARG++ AA+W    K +IPGLYSM+DV+
Sbjct: 234 ARGAVQAAVWLYENKREIPGLYSMQDVI 261


>gi|300924023|ref|ZP_07140023.1| dihydrodipicolinate reductase [Escherichia coli MS 182-1]
 gi|300419747|gb|EFK03058.1| dihydrodipicolinate reductase [Escherichia coli MS 182-1]
          Length = 273

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKENGLFDMRDVL 268


>gi|271502093|ref|YP_003335119.1| dihydrodipicolinate reductase [Dickeya dadantii Ech586]
 gi|270345648|gb|ACZ78413.1| dihydrodipicolinate reductase [Dickeya dadantii Ech586]
          Length = 273

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/273 (39%), Positives = 152/273 (55%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G     +
Sbjct: 1   MRDAQIRVAIAGAGGRMGRQLIQAALQMEGVVLGAALEREGSSLLGSDAGELAGAGKADV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L   +   D  IDF+ P  TL+ L    QH    +IGTTGF       I   A +
Sbjct: 61  TVQSSLEAVVNDFDVFIDFTRPEGTLKHLAFCRQHGKGMVIGTTGFDDAGKAAIQQAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L +  V  R      R   SIG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALGRDLKECAVYAREGYTGEREPKSIGFATIRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW  S+  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGAVRSALWVSSRNHGLFDMRDVLGL 270


>gi|188496339|ref|ZP_03003609.1| dihydrodipicolinate reductase [Escherichia coli 53638]
 gi|194439684|ref|ZP_03071754.1| dihydrodipicolinate reductase [Escherichia coli 101-1]
 gi|253774937|ref|YP_003037768.1| dihydrodipicolinate reductase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160157|ref|YP_003043265.1| dihydrodipicolinate reductase [Escherichia coli B str. REL606]
 gi|297519223|ref|ZP_06937609.1| dihydrodipicolinate reductase [Escherichia coli OP50]
 gi|300928674|ref|ZP_07144193.1| dihydrodipicolinate reductase [Escherichia coli MS 187-1]
 gi|188491538|gb|EDU66641.1| dihydrodipicolinate reductase [Escherichia coli 53638]
 gi|194421369|gb|EDX37386.1| dihydrodipicolinate reductase [Escherichia coli 101-1]
 gi|242375871|emb|CAQ30551.1| dihydrodipicolinate reductase [Escherichia coli BL21(DE3)]
 gi|253325981|gb|ACT30583.1| dihydrodipicolinate reductase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972058|gb|ACT37729.1| dihydrodipicolinate reductase [Escherichia coli B str. REL606]
 gi|253976267|gb|ACT41937.1| dihydrodipicolinate reductase [Escherichia coli BL21(DE3)]
 gi|300463343|gb|EFK26836.1| dihydrodipicolinate reductase [Escherichia coli MS 187-1]
 gi|309700244|emb|CBI99532.1| dihydrodipicolinate reductase [Escherichia coli ETEC H10407]
 gi|323935082|gb|EGB31449.1| dihydrodipicolinate reductase [Escherichia coli E1520]
 gi|323959978|gb|EGB55624.1| dihydrodipicolinate reductase [Escherichia coli H489]
 gi|323970703|gb|EGB65957.1| dihydrodipicolinate reductase [Escherichia coli TA007]
          Length = 273

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|293417906|ref|ZP_06660528.1| dihydrodipicolinate reductase [Escherichia coli B185]
 gi|291430624|gb|EFF03622.1| dihydrodipicolinate reductase [Escherichia coli B185]
          Length = 273

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|171463049|ref|YP_001797162.1| Dihydrodipicolinate reductase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|238692843|sp|B1XT71|DAPB_POLNS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|171192587|gb|ACB43548.1| Dihydrodipicolinate reductase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 266

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 158/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N     L   +  +  P +G+D G F+G    G+  S +
Sbjct: 1   MKIAIAGTIGRMGKMLIEAVLNTADAQLVGALEHTSCPQLGEDAGAFLG-KKTGVLISSD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +A  + +   +IDF+ P  T+  L I+ +     IIGTTG S  +   +   + N  IV 
Sbjct: 60  VAQVLANAQFLIDFTRPEGTMAHLAIAEKTGTKMIIGTTGLSADQIAGLKKVSANLAIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+ L  ++ +D EI+E HH+ K+D+PSGTAL +GE IA    
Sbjct: 120 APNMSVGVNATFKLLEIAAKML--SQGYDIEIIEAHHKHKVDAPSGTALKMGEVIAEALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      R EGSIG A +R G IVG+H+V+ AG+GE I +SH +  R+ +
Sbjct: 178 EKLDDVAVYAREGHTGERKEGSIGFAIIRGGDIVGDHTVLFAGDGERIEISHKSSSRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+GSL AA + ++Q  GL+ M+DVLG+
Sbjct: 238 AQGSLRAARFLQNQKNGLFDMQDVLGL 264


>gi|114329072|ref|YP_746229.1| dihydrodipicolinate reductase [Granulibacter bethesdensis CGDNIH1]
 gi|122325982|sp|Q0BPE6|DAPB_GRABC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|114317246|gb|ABI63306.1| dihydrodipicolinate reductase [Granulibacter bethesdensis CGDNIH1]
          Length = 261

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 153/267 (57%), Gaps = 14/267 (5%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI + G  GRMG  L++E     +++  ++   S SP            +P+GI    +
Sbjct: 7   IRIGIAGMAGRMGSLLVEEAAAQGTVSGGTLRPGSNSP------------APVGIPAFAD 54

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +    ++ D +IDF+S +         ++     I+GT+G S  + + +   A   P+V 
Sbjct: 55  INTLAEASDAVIDFTSASTVQAHARALSKAGTAWILGTSGLSPADEKAVEEIAALVPVVY 114

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N + G+N +  L E  A  L P   +D EI+EMHHRRK+DSPSGTA+ LG A+A GR 
Sbjct: 115 APNFAPGVNLVLALAEKMAAAL-PGNRYDAEIVEMHHRRKIDSPSGTAIGLGRAVAAGRG 173

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L + +   RH     R  G+IG A+LR G +VGEH+++ A + E I L+H A+DRR F
Sbjct: 174 VMLEEVIESGRHGHVGPRQPGAIGFAALRGGQVVGEHTLLFAADDEHIALTHRAFDRRAF 233

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALW + + PGLYSM DVLG+
Sbjct: 234 ARGAVQAALWVQGKPPGLYSMMDVLGM 260


>gi|91689160|gb|ABE32360.1| dihydrodipicolinate reductase [Burkholderia xenovorans LB400]
          Length = 254

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 99/256 (38%), Positives = 152/256 (59%), Gaps = 3/256 (1%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+ LI+ + N+   TL   + R GSP +GQD G F+G    G+  +D++       D +
Sbjct: 1   MGRMLIETVLNDSDATLSGALDRVGSPQLGQDAGAFLG-KQTGVVLTDDIERVFAESDYL 59

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF+ P  TL  L  + +HN+  +IGTTGF  ++   + + A    I+ +SNMS+G+N  
Sbjct: 60  IDFTRPEGTLVHLEAAQRHNVKMVIGTTGFDNEQKAQLRAAADRIAIMFASNMSVGVNVT 119

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L+E AA++   A  +D EI+E HHR K+D+PSGTAL +GE IA+    NL D  V +R
Sbjct: 120 LKLLEYAAKHF--ATGYDIEIIEAHHRHKVDAPSGTALTMGEVIAHALGRNLDDCAVYSR 177

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                 R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +A+G+L A  + 
Sbjct: 178 EGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSYAQGALRAVRFL 237

Query: 256 KSQIPGLYSMRDVLGI 271
           +    G + M+DVLG+
Sbjct: 238 EGHATGFFDMQDVLGL 253


>gi|187732869|ref|YP_001878855.1| dihydrodipicolinate reductase [Shigella boydii CDC 3083-94]
 gi|238689485|sp|B2U250|DAPB_SHIB3 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|187429861|gb|ACD09135.1| dihydrodipicolinate reductase [Shigella boydii CDC 3083-94]
          Length = 273

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 152/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSRESHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +A W   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSAFWLSGKESGLFDMRDVL 268


>gi|330991337|ref|ZP_08315288.1| Dihydrodipicolinate reductase [Gluconacetobacter sp. SXCC-1]
 gi|329761356|gb|EGG77849.1| Dihydrodipicolinate reductase [Gluconacetobacter sp. SXCC-1]
          Length = 259

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 157/268 (58%), Gaps = 16/268 (5%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI + G  GR+G+ L +E+    ++ L     R G+P+ G D   +  IS +  +    
Sbjct: 1   MRIGIAGLNGRVGRLLAEEVPAGGAL-LVGGTTRDGAPVTGIDCPVYADISDLAPQ---- 55

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQ-HNIVHIIGTTGFSVKENEVISSFARNAPIV 123
                   D +IDF+  A T+++  I+        ++GTTG S +E + + + AR   +V
Sbjct: 56  -------CDVVIDFTHVA-TVETHAIALTLAGTAWVLGTTGLSTREQQAVDTTARRIAVV 107

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
           +++N S G+  +  L        LP  D+D EILEMHHR+K+D+PSGTAL +G A+A GR
Sbjct: 108 QAANFSPGVTLVTRLARQMGA-ALPGSDYDAEILEMHHRQKVDAPSGTALAMGRAVAEGR 166

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
            + L +H+   R      RT+G+IG A+LR G IVGEHSV+     E I+L+H ++DRR+
Sbjct: 167 GIRLEEHIESGRDGHTGPRTDGAIGFAALRGGQIVGEHSVIFTSSHEQISLTHRSFDRRV 226

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +A G++ AA W +++ PGLY M DVLG+
Sbjct: 227 YATGAVRAAQWLRTRPPGLYDMEDVLGL 254


>gi|253999586|ref|YP_003051649.1| dihydrodipicolinate reductase [Methylovorus sp. SIP3-4]
 gi|253986265|gb|ACT51122.1| dihydrodipicolinate reductase [Methylovorus sp. SIP3-4]
          Length = 268

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 154/258 (59%), Gaps = 3/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG AL++ +  + ++ LH+ + RS SP +G+D G   G    G+  S ++A A+   D
Sbjct: 13  GRMGYALLEGVFADEALQLHAALDRSDSPQLGRDAGEQFG-RKTGVLISHDVAAALAGAD 71

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            ++DF+ P  +LQ L    Q  +  +IGTTGF+ ++ + I + + +  +V + NMS+G+ 
Sbjct: 72  VLVDFTRPEPSLQYLQACRQAGVAMVIGTTGFTPEQKQQIEAASADIAVVFAPNMSVGVT 131

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV+ AA+ L  ++ +D E++E HHR K+D+PSGTAL LGEA A     +L    V 
Sbjct: 132 LLINLVKEAAKVL--SEGYDIEVIEAHHRHKVDAPSGTALRLGEAAAEALGRDLASCAVY 189

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R   +IG A++R G +VG+H+V+ AG GE + L+H A  R  FA G+L AA 
Sbjct: 190 GREGVTGERDPSTIGFATVRGGDVVGDHTVLFAGIGERVELTHKASSRATFALGALRAAK 249

Query: 254 WAKSQIPGLYSMRDVLGI 271
           +   +  GL+ MRDVL +
Sbjct: 250 FLTGRSSGLFDMRDVLSL 267


>gi|206889964|ref|YP_002249392.1| dihydrodipicolinate reductase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206890177|ref|YP_002249442.1| dihydrodipicolinate reductase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741902|gb|ACI20959.1| dihydrodipicolinate reductase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742115|gb|ACI21172.1| dihydrodipicolinate reductase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 267

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 152/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMG  ++    + P + L   I    +P IG D G   GI  +G+K  D 
Sbjct: 2   IKIAVCGAAGRMGSRIVALSRDYPELKLTGAIESKTNPKIGTDAGIIAGIGEIGVKIDDR 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  AI + D +I+F+SP  TL+ L I  +     +IGTTGFS ++  +I   ++  PIV 
Sbjct: 62  LEKAIDNADVVINFTSPEATLEHLEIVKKFKKSMVIGTTGFSNEQLSIIQKASKKIPIVL 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMS+G+N L  +++  A+ L    D+D EI+E HHR K D+PSGTA+ + + IA    
Sbjct: 122 SPNMSIGVNLLFKILKDVAKVL--GDDYDIEIVEAHHRMKKDAPSGTAIKMAKVIAEALN 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            N  +  V  R      RT+  IGI ++RAG IVGEH+V+  G GE I + H A  R  F
Sbjct: 180 RNFDEVAVYARKGIIGERTKKEIGIQTVRAGDIVGEHTVIFGGLGERIEIIHKASSRDTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG+L A +W   +  G Y M DVLGI
Sbjct: 240 ARGALRAVIWLYGKPAGFYDMGDVLGI 266


>gi|15676130|ref|NP_273261.1| dihydrodipicolinate reductase [Neisseria meningitidis MC58]
 gi|14547970|sp|Q9K1F1|DAPB_NEIMB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|7225424|gb|AAF40660.1| dihydrodipicolinate reductase [Neisseria meningitidis MC58]
          Length = 269

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDTGKAAIHTAAEKTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|186477339|ref|YP_001858809.1| dihydrodipicolinate reductase [Burkholderia phymatum STM815]
 gi|226724131|sp|B2JGX9|DAPB_BURP8 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|184193798|gb|ACC71763.1| Dihydrodipicolinate reductase [Burkholderia phymatum STM815]
          Length = 265

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 157/267 (58%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N+P + L   + R+G+P +GQD G F+G    G+  SD+
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNDPEVKLSGALDRTGAPQLGQDAGAFLG-KQTGVLMSDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+ P  TL  +  + + N   +IGTTGF   +   I + +    IV 
Sbjct: 60  IDAVLAQSDYLIDFTRPDGTLAHIEAALRTNTKLVIGTTGFDDAQKARIRAASEKTGIVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           +SN S+G+N    L+E AA +   ++ +D EI+E HHR K+D+PSGTAL +GE IA    
Sbjct: 120 ASNFSVGVNVTMKLLEFAARHF--SQGYDIEIIEAHHRHKVDAPSGTALTMGEVIAGALG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 178 RKLEDCAVYAREGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRLSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G+L A  + +    GL+ M+DVLG+
Sbjct: 238 AQGALRAVRFLEGHSNGLFDMQDVLGL 264


>gi|86160484|ref|YP_467269.1| dihydrodipicolinate reductase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497145|sp|Q2IGX0|DAPB_ANADE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|85776995|gb|ABC83832.1| dihydrodipicolinate reductase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 270

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 148/258 (57%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG  +++ +   P +++   + R+GSP IG+D G   G  P+G+   D+LA A+   D
Sbjct: 11  GRMGTQIVRLVRATPGLSVSGAVERAGSPAIGKDAGTLAGGEPLGVAVVDDLAKALPGAD 70

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+S   +++     A   +  +IG+TGF+      ++  AR  P+V S NMS+G+N
Sbjct: 71  VVIDFTSHEASVRHAQACAAAGVALVIGSTGFTPDAKAKVAEAARKVPVVLSPNMSVGVN 130

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            +  LV  AA  L  A  +D E++E+HH+ K D+PSGTA+ LGE  A        D +  
Sbjct: 131 VVFELVRQAARVLGDA--YDVEVVEIHHKHKRDAPSGTAVRLGEVAAEALGRAPADALAY 188

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
           +RH     R    IGI +LR G +VGEH+V   GEGE + ++H A  R  FARG+  AA 
Sbjct: 189 SRHGILGERPPWQIGIQTLRGGDVVGEHTVFFCGEGERVEITHRATSREQFARGAARAAA 248

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG+Y M DVLG+
Sbjct: 249 WLPGKAPGVYDMADVLGL 266


>gi|309379090|emb|CBX22221.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 269

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      +
Sbjct: 61  DDVDTVLAQSDVLIDFTRPEPTLKHLQKCVEKGVCIIIGTTGFDDAGKAAIRAAGEKTGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEAHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|304389015|ref|ZP_07371061.1| dihydrodipicolinate reductase [Neisseria meningitidis ATCC 13091]
 gi|304336996|gb|EFM03184.1| dihydrodipicolinate reductase [Neisseria meningitidis ATCC 13091]
 gi|325129003|gb|EGC51853.1| dihydrodipicolinate reductase [Neisseria meningitidis N1568]
 gi|325145396|gb|EGC67673.1| dihydrodipicolinate reductase [Neisseria meningitidis M01-240013]
 gi|325205292|gb|ADZ00745.1| dihydrodipicolinate reductase [Neisseria meningitidis M04-240196]
          Length = 269

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIHTAAEQTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|145629377|ref|ZP_01785175.1| dihydrodipicolinate reductase [Haemophilus influenzae 22.1-21]
 gi|145638877|ref|ZP_01794485.1| dihydrodipicolinate reductase [Haemophilus influenzae PittII]
 gi|144978220|gb|EDJ87984.1| dihydrodipicolinate reductase [Haemophilus influenzae 22.1-21]
 gi|145271849|gb|EDK11758.1| dihydrodipicolinate reductase [Haemophilus influenzae PittII]
 gi|309750854|gb|ADO80838.1| Dihydrodipicolinate reductase [Haemophilus influenzae R2866]
          Length = 270

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 150/268 (55%), Gaps = 3/268 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G DVG   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDVGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 DRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ A  W +++  GL+ M DVL +
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVLDL 267


>gi|307245539|ref|ZP_07527626.1| hypothetical protein appser1_7430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306853598|gb|EFM85816.1| hypothetical protein appser1_7430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
          Length = 269

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 149/266 (56%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L+    +   +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLSQNT-NFGVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQTAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGIIGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|15799713|ref|NP_285725.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 EDL933]
 gi|15829288|ref|NP_308061.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str. Sakai]
 gi|168751715|ref|ZP_02776737.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168756855|ref|ZP_02781862.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762791|ref|ZP_02787798.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168766719|ref|ZP_02791726.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776947|ref|ZP_02801954.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781728|ref|ZP_02806735.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785082|ref|ZP_02810089.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str. EC869]
 gi|168801912|ref|ZP_02826919.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str. EC508]
 gi|195937704|ref|ZP_03083086.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806960|ref|ZP_03249297.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814011|ref|ZP_03255340.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819191|ref|ZP_03259511.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209399811|ref|YP_002268637.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217324816|ref|ZP_03440900.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254791166|ref|YP_003076003.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261226789|ref|ZP_05941070.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255192|ref|ZP_05947725.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291280854|ref|YP_003497672.1| Dihydrodipicolinate reductase [Escherichia coli O55:H7 str. CB9615]
 gi|14547951|sp|P58209|DAPB_ECO57 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226696351|sp|B5YYC3|DAPB_ECO5E RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|12512714|gb|AAG54333.1|AE005179_10 dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EDL933]
 gi|13359490|dbj|BAB33457.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str. Sakai]
 gi|187767730|gb|EDU31574.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014304|gb|EDU52426.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000711|gb|EDU69697.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189356101|gb|EDU74520.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189364000|gb|EDU82419.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189366939|gb|EDU85355.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189375080|gb|EDU93496.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str. EC869]
 gi|189376001|gb|EDU94417.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str. EC508]
 gi|208726761|gb|EDZ76362.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735288|gb|EDZ83975.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739314|gb|EDZ86996.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161211|gb|ACI38644.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209747074|gb|ACI71844.1| dihydrodipicolinate reductase [Escherichia coli]
 gi|209747076|gb|ACI71845.1| dihydrodipicolinate reductase [Escherichia coli]
 gi|209747078|gb|ACI71846.1| dihydrodipicolinate reductase [Escherichia coli]
 gi|209747080|gb|ACI71847.1| dihydrodipicolinate reductase [Escherichia coli]
 gi|209747082|gb|ACI71848.1| dihydrodipicolinate reductase [Escherichia coli]
 gi|217321037|gb|EEC29461.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254590566|gb|ACT69927.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           TW14359]
 gi|290760727|gb|ADD54688.1| Dihydrodipicolinate reductase [Escherichia coli O55:H7 str. CB9615]
 gi|320190450|gb|EFW65100.1| Dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320642071|gb|EFX11422.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str. G5101]
 gi|320647434|gb|EFX16229.1| dihydrodipicolinate reductase [Escherichia coli O157:H- str.
           493-89]
 gi|320652768|gb|EFX21006.1| dihydrodipicolinate reductase [Escherichia coli O157:H- str. H
           2687]
 gi|320658157|gb|EFX25886.1| dihydrodipicolinate reductase [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320663466|gb|EFX30750.1| dihydrodipicolinate reductase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320668778|gb|EFX35573.1| dihydrodipicolinate reductase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326345253|gb|EGD68996.1| Dihydrodipicolinate reductase [Escherichia coli O157:H7 str. 1125]
 gi|326346894|gb|EGD70628.1| Dihydrodipicolinate reductase [Escherichia coli O157:H7 str. 1044]
          Length = 273

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKENGLFDMRDVL 268


>gi|260596460|ref|YP_003209031.1| dihydrodipicolinate reductase [Cronobacter turicensis z3032]
 gi|260215637|emb|CBA27919.1| Dihydrodipicolinate reductase [Cronobacter turicensis z3032]
          Length = 273

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 149/273 (54%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M ++ +R+++ G  GRMG+ LI+       + L + +VR GS L+G D G   G    G+
Sbjct: 1   MQEAQVRVAIAGANGRMGRQLIQAALAMDGVALGAALVREGSSLLGADAGELAGAGATGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               ++       D +IDF+ P  TL  L     H    +IGTTGF       I   A  
Sbjct: 61  TLQSSIEAVKNDFDVLIDFTRPEGTLAYLAFCRAHGKGMVIGTTGFDDAGKAAIREAAAA 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
            P+V ++N S+G+N +  L+E  A+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IPVVFAANFSVGVNVMLKLLEKTAQVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L    V  R      R  G+IG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALNKDLQSCAVYAREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +A W K +  GLY MRDVL +
Sbjct: 238 SSRMTFANGAVRSAFWLKGRETGLYDMRDVLNL 270


>gi|326561786|gb|EGE12121.1| dihydrodipicolinate reductase [Moraxella catarrhalis 7169]
          Length = 265

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 150/267 (56%), Gaps = 7/267 (2%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + ++I ++G  GRMG+ LI+   N+P+  L    VRS S LIG D G F+G    G+  S
Sbjct: 2   NKLKIGIMGASGRMGRMLIESTMNHPNTELGGAYVRSTSSLIGVDAGEFIGGKKSGVVLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
               +    VD +IDFS P    ++LN    H I  ++G TG S  +   +   A++  I
Sbjct: 62  ---TLDGSQVDVMIDFSLPEAFDEALNQCVTHKIPLVMGVTGLSDDQEAKLQDAAKHIAI 118

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + N S G+N    L+ T A  L    D D EI+E HH+ K+D+PSGTAL++ +AI   
Sbjct: 119 VYAGNYSTGVNLSLNLLATTARVL--GLDADVEIIEHHHKHKIDAPSGTALMMAQAITEA 176

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           R  N+T+  +  R      R  G IGI +LR G IVGEH+V    +GE I ++H A +R 
Sbjct: 177 RGQNITNAAIYGRK-GAAKRQRGDIGIHALRGGEIVGEHTVEFMMDGEIIQITHKAQNRA 235

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVL 269
            FA G+L AALWA  Q  GLY M+DVL
Sbjct: 236 TFATGALRAALWAAQQPAGLYDMQDVL 262


>gi|145630806|ref|ZP_01786584.1| dihydrodipicolinate reductase [Haemophilus influenzae R3021]
 gi|144983688|gb|EDJ91148.1| dihydrodipicolinate reductase [Haemophilus influenzae R3021]
          Length = 270

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E+LE HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVLEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|53729186|ref|ZP_00134031.2| COG0289: Dihydrodipicolinate reductase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 269

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 148/266 (55%), Gaps = 4/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I ++G GGRMG+ LI  + N   + L +   R GS L+G D G   GI   G+K SD
Sbjct: 2   TLKIGIVGAGGRMGRNLITAVQNAEGVELGAAFERKGSSLVGADAGEVAGIGATGVKISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L     + D +IDF+ P  TL+ +     +    +IGTTGF     + I + A    IV
Sbjct: 62  DLNQNT-NFDVLIDFTRPEGTLEHIKFCVANGKKMVIGTTGFDDAGKQAIQTAAEQISIV 120

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+ +PSGTAL +GE IA   
Sbjct: 121 FASNYSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVAAPSGTALSMGEHIAKTL 178

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RAG +VGEHSV  A EGE + ++H A  R  
Sbjct: 179 GRDLKTHGVFAREGITGERKRDEIGFATIRAGDVVGEHSVWFADEGERVEIAHKASSRMT 238

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 FANGAVRAAKWLNTKQNGLFDMTDVL 264


>gi|260222012|emb|CBA31151.1| Dihydrodipicolinate reductase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 269

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 151/258 (58%), Gaps = 3/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI  +      +L   +  +GSP +G D G F G    G+  + ++   +++  
Sbjct: 14  GRMGQMLIDAVRAADDCSLAGALDIAGSPSLGLDAGAFSG-QATGVLITADVREGLKNSQ 72

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+ P  TL  L +  +  +  +IGTTGF+ ++   I+  A++ PI+ + NMS+G+N
Sbjct: 73  ALIDFTRPEGTLAHLQVCRELGVAAVIGTTGFTDEQKAEIAEIAKSIPIMMAPNMSVGVN 132

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
               L+E AA+ L  A  +D EI+E HHR K+D+PSGTAL +GE IA+    +L +  V 
Sbjct: 133 VTLKLLEMAAKAL--ATGYDIEIVEAHHRHKVDAPSGTALKMGEVIADALGRDLKECAVY 190

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R+     R   SIG A++R G IVG+H+V+ AG GE I +SH +  R  +A+GSL A  
Sbjct: 191 ERYGVTGERDPSSIGFATIRGGDIVGDHTVLFAGTGERIEISHKSSSRATYAQGSLRAVR 250

Query: 254 WAKSQIPGLYSMRDVLGI 271
           +   + PGLY M DVL +
Sbjct: 251 FLAGRAPGLYDMFDVLNL 268


>gi|220919295|ref|YP_002494599.1| Dihydrodipicolinate reductase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254767031|sp|B8JAN4|DAPB_ANAD2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|219957149|gb|ACL67533.1| Dihydrodipicolinate reductase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 270

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 145/258 (56%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG  +++ +   P + +   + R+GSP IG+D G   G  P+G+   D+LA A+   D
Sbjct: 11  GRMGTQIVRLVRATPGLAVSGAVERAGSPAIGKDAGTLAGGEPLGVAVVDDLAKALAGAD 70

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+S   +++     A   +  +IG+TGF+      ++  AR  P+V S NMS+G+N
Sbjct: 71  VVIDFTSHEASVRHAQACAAAGVALVIGSTGFTPDAKAKVAEAARKVPVVLSPNMSVGVN 130

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            +  LV  AA  L     +D EI+E+HH+ K D+PSGTA+ LGE  A        D +  
Sbjct: 131 VVFELVRQAARVL--GDGYDVEIVEIHHKHKRDAPSGTAVRLGEVAAEALGRAPADALAY 188

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            RH     R    IGI +LR G +VGEH+V   GEGE + ++H A  R  FARG+  AA 
Sbjct: 189 TRHGILGERPPWQIGIQTLRGGDVVGEHTVFFCGEGERVEITHRATSREQFARGAARAAA 248

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG+Y M DVLG+
Sbjct: 249 WLPGKPPGVYDMADVLGL 266


>gi|222112435|ref|YP_002554699.1| dihydrodipicolinate reductase [Acidovorax ebreus TPSY]
 gi|221731879|gb|ACM34699.1| dihydrodipicolinate reductase [Acidovorax ebreus TPSY]
          Length = 273

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 156/269 (57%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P R++V G  GRMG+ LI+ I  +    L   + + G+P +G D   F+G +  G+  +
Sbjct: 7   APRRVAVAGASGRMGRMLIEAIQASDGCVLAGALDQPGNPAVGTDAAAFLGCAS-GVVIT 65

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L   ++  D +IDF+ P  TL  L + A+  +  +IGTTGFS  +   I + A+   I
Sbjct: 66  ADLREGLKDADVLIDFTRPEGTLAHLAVCAELGVQMVIGTTGFSDAQKAQIEAAAQKVGI 125

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L++ AA+ L     +D EI+E HH+ K+D+PSGTAL +GE IA  
Sbjct: 126 VFAPNMSVGVNVTLKLLQMAAQALRTG--YDIEIIEAHHKHKVDAPSGTALKMGEVIAEA 183

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           +   L D  V  R+     R   +IG A++R G IVG+H+V+ AG GE + +SH +  R 
Sbjct: 184 QGTRLADRAVYERYGHTGERKADTIGFATVRGGDIVGDHTVLFAGTGERVEISHKSSSRA 243

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+GSL A  +  +Q  GL+ M DVL +
Sbjct: 244 GYAQGSLRAVGFLATQRAGLFDMFDVLNL 272


>gi|291613519|ref|YP_003523676.1| dihydrodipicolinate reductase [Sideroxydans lithotrophicus ES-1]
 gi|291583631|gb|ADE11289.1| dihydrodipicolinate reductase [Sideroxydans lithotrophicus ES-1]
          Length = 267

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 103/265 (38%), Positives = 156/265 (58%), Gaps = 5/265 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +++++ G GGRMG+ L++ +     +TLH+ +   GS L+ QD     G    G+    +
Sbjct: 4   IKVAIAGSGGRMGKVLLECVAQADDLTLHAALEHGGSALLKQDASVLGG--SKGVTIMAD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
              A+Q  D +IDF+ P  TL  L I  +H +  +IGTTGF+ ++   + + A++  IV 
Sbjct: 62  AEQALQGADVLIDFTRPEGTLHHLEICRKHRVNMVIGTTGFNAQQKAQLGAAAQDIGIVF 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N +  L+ETA+  L  A  +D E++E HHR K+D+PSGTAL +GE IA    
Sbjct: 122 APNMSVGVNLVFKLLETASRVL--ANGYDIEVIEAHHRHKVDAPSGTALGMGEVIARTLG 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R      R   +IG A++R G IVG+H+V+ AG GE I ++H A  R  F
Sbjct: 180 RDLGQCAVYGREGVTGERDPSTIGFATVRGGDIVGDHTVLYAGIGERIEITHKASSRATF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A G+L AA + K+   GLY M+DVL
Sbjct: 240 ALGALRAARFLKANKAGLYDMQDVL 264


>gi|325131030|gb|EGC53756.1| dihydrodipicolinate reductase [Neisseria meningitidis OX99.30304]
 gi|325135126|gb|EGC57753.1| dihydrodipicolinate reductase [Neisseria meningitidis M13399]
 gi|325137033|gb|EGC59629.1| dihydrodipicolinate reductase [Neisseria meningitidis M0579]
 gi|325202965|gb|ADY98419.1| dihydrodipicolinate reductase [Neisseria meningitidis M01-240149]
 gi|325207237|gb|ADZ02689.1| dihydrodipicolinate reductase [Neisseria meningitidis NZ-05/33]
          Length = 269

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIHTAAEQTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|197124572|ref|YP_002136523.1| dihydrodipicolinate reductase [Anaeromyxobacter sp. K]
 gi|238689880|sp|B4UHF2|DAPB_ANASK RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|196174421|gb|ACG75394.1| Dihydrodipicolinate reductase [Anaeromyxobacter sp. K]
          Length = 270

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 145/258 (56%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG  +++ +   P + +   + R+GSP IG+D G   G  P+G+   D+LA A+   D
Sbjct: 11  GRMGTQIVRLVRATPGLAVSGAVERAGSPAIGKDAGTLAGGEPLGVAVMDDLARALAGAD 70

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+S   +++     A   +  +IG+TGF+      ++  AR  P+V S NMS+G+N
Sbjct: 71  VVIDFTSHEASVRHAQACAAAGVALVIGSTGFTPDAKAKVAEAARKVPVVLSPNMSVGVN 130

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            +  LV  AA  L     +D EI+E+HH+ K D+PSGTA+ LGE  A        D +  
Sbjct: 131 VVFELVRQAARVL--GDGYDVEIVEIHHKHKRDAPSGTAVRLGEVAAEALGRAPADALAY 188

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            RH     R    IGI +LR G +VGEH+V   GEGE + ++H A  R  FARG+  AA 
Sbjct: 189 TRHGILGERPPWQIGIQTLRGGDVVGEHTVFFCGEGERVEITHRATSREQFARGAARAAA 248

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   + PG+Y M DVLG+
Sbjct: 249 WLPGKPPGVYDMADVLGL 266


>gi|82775433|ref|YP_401780.1| dihydrodipicolinate reductase [Shigella dysenteriae Sd197]
 gi|90101259|sp|Q32K66|DAPB_SHIDS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|81239581|gb|ABB60291.1| dihydrodipicolinate reductase [Shigella dysenteriae Sd197]
          Length = 273

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R G+ L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGASLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|161870858|ref|YP_001600031.1| dihydrodipicolinate reductase [Neisseria meningitidis 053442]
 gi|189082800|sp|A9M3H7|DAPB_NEIM0 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|161596411|gb|ABX74071.1| dihydrodipicolinate reductase [Neisseria meningitidis 053442]
 gi|254672166|emb|CBA04993.1| Dihydrodipicolinate reductase [Neisseria meningitidis alpha275]
 gi|261391738|emb|CAX49187.1| dihydrodipicolinate reductase (DHPR) [Neisseria meningitidis 8013]
 gi|319411313|emb|CBY91724.1| dihydrodipicolinate reductase (DHPR) [Neisseria meningitidis WUE
           2594]
          Length = 269

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIHTAAEQTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKAGSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|301330205|ref|ZP_07222865.1| dihydrodipicolinate reductase [Escherichia coli MS 78-1]
 gi|300843767|gb|EFK71527.1| dihydrodipicolinate reductase [Escherichia coli MS 78-1]
          Length = 273

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 154/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL+ L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLKHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ M+DVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMQDVL 268


>gi|215485192|ref|YP_002327623.1| dihydrodipicolinate reductase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|254767046|sp|B7UI76|DAPB_ECO27 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|215263264|emb|CAS07579.1| dihydrodipicolinate reductase [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 273

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAIKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  G++ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGIFDMRDVL 268


>gi|300309941|ref|YP_003774033.1| dihydrodipicolinate reductase [Herbaspirillum seropedicae SmR1]
 gi|124483490|emb|CAM32618.1| Dihydrodipicolinate reductase protein [Herbaspirillum seropedicae]
 gi|300072726|gb|ADJ62125.1| dihydrodipicolinate reductase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 268

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 151/267 (56%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           + I+V G  GRMG+ LI+ I N   + L   +    SP IG D G F+G    G+    +
Sbjct: 4   LNIAVAGASGRMGRMLIEAILNADDLQLAGALDTPTSPSIGTDAGLFLG-KATGVLIESD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA  +   D +IDF+ P  TL+ L   A H +  +IGTTGF  +    I+++A    I+ 
Sbjct: 63  LARGLAKADVLIDFTRPEGTLKHLEYCAAHGVKVVIGTTGFEPEGKAAIAAYAEKTAIMA 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+    +  +D EI+E HHR K+D+PSGTAL +GE IA+   
Sbjct: 123 APNMSVGVNVTMKLLEMAAKNF--SHGYDIEIIEAHHRFKVDAPSGTALKMGEVIADALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L D  V  R      R   SIG A++R G I+G+H+V+ AG GE I +SH +  R  +
Sbjct: 181 KKLDDVAVYAREGVTGERDPSSIGFATVRGGDIIGDHTVLFAGIGERIEISHKSSSRVSY 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A GSL AA +   +  GLY M+DVLG 
Sbjct: 241 AMGSLRAARYLADKETGLYDMQDVLGF 267


>gi|91762502|ref|ZP_01264467.1| Dihydrodipicolinate reductase [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718304|gb|EAS84954.1| Dihydrodipicolinate reductase [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 258

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 151/259 (58%), Gaps = 19/259 (7%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LI+   NN +  L ++   + +  I + +         GIK   N     +  D
Sbjct: 13  GRMGQQLIRSSKNNKNFKLTAL---TENKAISKKIA--------GIKLDVNTEETFKKTD 61

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            IIDF+ PA TL  L I+++     +IGTTGF  KE  +I  F++  PI+K+ NMSLG+N
Sbjct: 62  VIIDFTVPACTLDILKIASKLKKRIVIGTTGFDQKEEALIKKFSKTIPILKAGNMSLGVN 121

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHM-- 191
            L +L E A++ L   +++  ++ E+HH+ K D PSGTAL+LG+ IA+G+  NL + M  
Sbjct: 122 LLMYLTEIASKSL--NEEYLSKVFEVHHKHKKDYPSGTALMLGKGIADGKNKNLYNLMGK 179

Query: 192 -VLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLT 250
             LN+      +    I   S+R G I+GEH V  +   E I LSH A+DR +++ G+LT
Sbjct: 180 KFLNKKSFPYGK---KINFNSIRKGEIIGEHEVTFSSGKEIIKLSHEAFDRALYSDGALT 236

Query: 251 AALWAKSQIPGLYSMRDVL 269
           AA W  ++ PGLYSMRD+L
Sbjct: 237 AAKWLINKKPGLYSMRDLL 255


>gi|238020566|ref|ZP_04600992.1| hypothetical protein GCWU000324_00452 [Kingella oralis ATCC 51147]
 gi|237867546|gb|EEP68552.1| hypothetical protein GCWU000324_00452 [Kingella oralis ATCC 51147]
          Length = 269

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 161/269 (59%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + ++I++ G  GRMG+ L++ +  NP+  L   + R+GS ++G D G  +GI   G+K +
Sbjct: 2   AQLKIAIAGANGRMGRTLVQAVEANPNTVLTGALDRAGSGVLGLDAGFALGIK-TGVKVT 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           DN  +A+   D +IDF+ P+ +L  +   A   I  +IGTTGF       I++ A+   I
Sbjct: 61  DNADIALDDADVLIDFTRPSASLPLIEKCAARGIKMVIGTTGFDDAGKAAIANAAQKNAI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T +  L     +D EI+E HH  K+D+PSGTAL +GE IAN 
Sbjct: 121 VFAANFSVGVNLTFHILDTVSRVL--NDGYDIEIIEAHHHHKVDAPSGTALRMGEVIANA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R     AR   +IG +++RAG IVGEH+ + A +GE + ++H A  R 
Sbjct: 179 VGRDLKECAVYGREGHTGARDPKTIGFSTIRAGDIVGEHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W ++   GL+ M+DVLG+
Sbjct: 239 TFAAGAVRAAVWLQNHPTGLFDMQDVLGL 267


>gi|326319251|ref|YP_004236923.1| dihydrodipicolinate reductase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323376087|gb|ADX48356.1| dihydrodipicolinate reductase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 284

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 157/270 (58%), Gaps = 5/270 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNN-PSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
           +P+R+++ G  GRMG+ LI+ +  +   + L   +   GSP +G D   F+G +  G+  
Sbjct: 16  APIRVAIAGASGRMGRMLIEALRGSGDELVLAGALDVPGSPSLGTDAAAFLGHAS-GVAI 74

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           + +L   +   D +IDF+ P  TL  L   A+H +  +IGTTGF+  +   I +FA+   
Sbjct: 75  TADLHEGLAGCDVLIDFTRPEGTLAHLAACAEHGVKAVIGTTGFTDAQKAEIEAFAQRTA 134

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           IV + NMS+G+N    L+E AA  L  +  +D EI+E HHR K+D+PSGTAL +GE IA 
Sbjct: 135 IVMAPNMSVGVNVTFKLLEMAARAL--STGYDIEIIEAHHRHKVDAPSGTALKMGEVIAQ 192

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
               +L D  V  R      R   +IG A++R G IVG+H+V+ AG GE I +SH +  R
Sbjct: 193 ALGRDLKDCAVYGREGLTGERDPSTIGFAAVRGGDIVGDHTVLFAGTGERIEISHKSSSR 252

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             +A+GSL AA +  +   GL+ M DVLG+
Sbjct: 253 SGYAQGSLRAARFLAAHRTGLFDMFDVLGL 282


>gi|308388422|gb|ADO30742.1| dihydrodipicolinate reductase [Neisseria meningitidis alpha710]
 gi|316985122|gb|EFV64074.1| dihydrodipicolinate reductase [Neisseria meningitidis H44/76]
 gi|325199412|gb|ADY94867.1| dihydrodipicolinate reductase [Neisseria meningitidis H44/76]
          Length = 269

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      +
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIQAAGEKTGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    L++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHLLDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|262370779|ref|ZP_06064103.1| dihydrodipicolinate reductase [Acinetobacter johnsonii SH046]
 gi|262314141|gb|EEY95184.1| dihydrodipicolinate reductase [Acinetobacter johnsonii SH046]
          Length = 273

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI VLG GGRMG+ LI+ +H      L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGVLGAGGRMGRILIQAVHE-AGYQLAAAVERPESSLVGTDAGELAGIGSLGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K   +L + ++  D IIDF++P  T+Q L I  +  +  +IGTTG + ++   +   A  
Sbjct: 59  KVVGSLEVVVKDCDVIIDFTAPVATVQHLKICREAGVAIVIGTTGMNDEQKAYLDDSATQ 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E A++        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 IPVVYAANYSVGVNVSIKLLEMASKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L    V  R      R   SIG  ++R G IVGEH+ +   +GE + ++H A 
Sbjct: 177 AGALGRDLKTDAVYCREGHTGPRERQSIGFQTIRGGDIVGEHTAMFIADGERVEITHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLG 270
           +R  FA G++ AA W   +    Y M+DVLG
Sbjct: 237 NRMNFASGAVRAADWVVGREARKYDMKDVLG 267


>gi|260582477|ref|ZP_05850268.1| dihydrodipicolinate reductase [Haemophilus influenzae NT127]
 gi|319897119|ref|YP_004135314.1| dihydrodipicolinate reductase [Haemophilus influenzae F3031]
 gi|260094457|gb|EEW78354.1| dihydrodipicolinate reductase [Haemophilus influenzae NT127]
 gi|317432623|emb|CBY80984.1| dihydrodipicolinate reductase [Haemophilus influenzae F3031]
          Length = 270

 Score =  181 bits (459), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E+LE HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVLEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|323519883|gb|ADX94264.1| dihydrodipicolinate reductase [Acinetobacter baumannii TCDC-AB0715]
          Length = 273

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 159/272 (58%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRTLIQAVQQ-AGYQLAAAVERPESSLVGTDAGELAGIGSVGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S NLA  ++  D IIDF++PA T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVSGNLAEVLKDCDVIIDFTAPAATAQHLKLCREAGVAMVIGTTGMSDEQKAELDEAATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|170704109|ref|ZP_02894728.1| Dihydrodipicolinate reductase [Burkholderia ambifaria IOP40-10]
 gi|170130982|gb|EDS99690.1| Dihydrodipicolinate reductase [Burkholderia ambifaria IOP40-10]
          Length = 254

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 155/256 (60%), Gaps = 3/256 (1%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+ LI+ + N+    L   + R+ SP +GQD G F+G    GIK +D+L       D +
Sbjct: 1   MGRMLIEAVLNDSDAQLVGALDRADSPFLGQDAGAFLG-KETGIKLTDDLDAVFAQADYL 59

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF+ P  T+  +  + +H++  +IGTTGF+ ++   + + A    IV ++NMS+G+N  
Sbjct: 60  IDFTRPEGTIAHVAAALRHDVKLVIGTTGFTAEQKAELQAAAARIGIVFAANMSVGVNVT 119

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L+E AA++   +  +D EI+E HHR K+D+PSGTAL++GEA+A     +L D  V  R
Sbjct: 120 LKLLEFAAKHF--SHGYDIEIIEAHHRHKVDAPSGTALMMGEAVAGALGRSLEDCAVYGR 177

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                 R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +A+G+L A  + 
Sbjct: 178 QGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIGERIEITHKSSSRVSYAQGALRAVRFL 237

Query: 256 KSQIPGLYSMRDVLGI 271
            ++  GL+ M+DVLG+
Sbjct: 238 SARGAGLFDMQDVLGL 253


>gi|145636226|ref|ZP_01791896.1| dihydrodipicolinate reductase [Haemophilus influenzae PittHH]
 gi|145270748|gb|EDK10681.1| dihydrodipicolinate reductase [Haemophilus influenzae PittHH]
          Length = 270

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 149/266 (56%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I+++G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIVGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|300919580|ref|ZP_07136072.1| dihydrodipicolinate reductase [Escherichia coli MS 115-1]
 gi|300413326|gb|EFJ96636.1| dihydrodipicolinate reductase [Escherichia coli MS 115-1]
          Length = 273

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 153/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L    +  D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKEDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HH  K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHGHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +R      R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|121634076|ref|YP_974321.1| dihydrodipicolinate reductase [Neisseria meningitidis FAM18]
 gi|166222660|sp|A1KRN3|DAPB_NEIMF RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|120865782|emb|CAM09511.1| dihydrodipicolinate reductase [Neisseria meningitidis FAM18]
 gi|325133125|gb|EGC55797.1| dihydrodipicolinate reductase [Neisseria meningitidis M6190]
 gi|325139093|gb|EGC61639.1| dihydrodipicolinate reductase [Neisseria meningitidis ES14902]
 gi|325141214|gb|EGC63714.1| dihydrodipicolinate reductase [Neisseria meningitidis CU385]
 gi|325143214|gb|EGC65554.1| dihydrodipicolinate reductase [Neisseria meningitidis 961-5945]
 gi|325197488|gb|ADY92944.1| dihydrodipicolinate reductase [Neisseria meningitidis G2136]
          Length = 269

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 153/268 (57%), Gaps = 5/268 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  SD
Sbjct: 3   PLKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           ++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      +V
Sbjct: 62  DVDTVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIQAAGEKTGVV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            ++N S+G+N    L++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FAANFSVGVNLTFHLLDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGAL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R  
Sbjct: 180 GRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 240 FAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|262380610|ref|ZP_06073764.1| dihydrodipicolinate reductase [Acinetobacter radioresistens SH164]
 gi|262298056|gb|EEY85971.1| dihydrodipicolinate reductase [Acinetobacter radioresistens SH164]
          Length = 273

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 157/272 (57%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI VLG GGRMG+ L++ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSATP-RIGVLGAGGRMGRILVQAVQQ-AGYQLAAAVERPESSLVGADAGELAGIGTLGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S  LA  +   D IIDF++PA T Q L +  +  +  +IGTTG + ++  V+   A  
Sbjct: 59  KVSGQLADVLNDCDVIIDFTAPAATEQHLKLCREAGVAMVIGTTGMNDEQKAVLEESASQ 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRERQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +  G Y M+DVLG 
Sbjct: 237 NRMNFAAGAVRAAAWVVGREAGKYDMKDVLGF 268


>gi|255318044|ref|ZP_05359289.1| dihydrodipicolinate reductase [Acinetobacter radioresistens SK82]
 gi|255304867|gb|EET84039.1| dihydrodipicolinate reductase [Acinetobacter radioresistens SK82]
          Length = 273

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 157/272 (57%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI VLG GGRMG+ L++ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSATP-RIGVLGAGGRMGRILVQAVQQ-AGYQLAAAVERPESSLVGADAGELAGIGTLGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S  LA  +   D IIDF++PA T Q L +  +  +  +IGTTG + ++  V+   A  
Sbjct: 59  KVSGQLADVLNDCDVIIDFTAPAATEQHLKLCREAGVAMVIGTTGMNDEQKAVLEESASQ 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRERQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +  G Y M+DVLG 
Sbjct: 237 NRMNFAAGAVRAAAWVVGREAGKYDMKDVLGF 268


>gi|238897847|ref|YP_002923526.1| dihydrodipicolinate reductase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465604|gb|ACQ67378.1| dihydrodipicolinate reductase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 273

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 151/267 (56%), Gaps = 4/267 (1%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            +R++++G  GRMG  LI+ +H + +  L + +VR  SPLI  D G F GI  + + FSD
Sbjct: 4   KVRMAIVGASGRMGLQLIQAVHQSQTARLVAALVRKKSPLINTDAGEFAGIGSIKVVFSD 63

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L     + D +IDF+SP  TL  L    +H    IIGTTGF     E I   A+   IV
Sbjct: 64  DLEAISDAFDIMIDFTSPQATLSHLAFCCKHQKSMIIGTTGFDEFGKEEIKKAAKKIGIV 123

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            S+N S+G+N +  L+E  A  +      D EI+E HHR K D+PSGTAL +GE IA   
Sbjct: 124 FSANFSIGVNLMLQLLEKTAAMI--GDHSDIEIIEAHHRYKKDAPSGTALAMGEKIAKAL 181

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    + +       R  G I  +++RAG IVGEH+V+ AG GES  ++H A  R  
Sbjct: 182 GKDLQKEAIFDLTASLNERALGKIHFSTIRAGDIVGEHTVLFAGVGESFEMTHKATSRIN 241

Query: 244 FARGSLTAALW-AKSQIPGLYSMRDVL 269
           FA G++ AALW AK    G++ M DVL
Sbjct: 242 FANGAVRAALWLAKKNQKGVFDMNDVL 268


>gi|117923826|ref|YP_864443.1| dihydrodipicolinate reductase [Magnetococcus sp. MC-1]
 gi|166222644|sp|A0L4Z4|DAPB_MAGSM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|117607582|gb|ABK43037.1| dihydrodipicolinate reductase [Magnetococcus sp. MC-1]
          Length = 268

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 141/258 (54%), Gaps = 2/258 (0%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+ L++  H      L +     G  LIG D G   G+  +G+    +     +  D
Sbjct: 12  GRMGRMLVEATHKAQGCMLGAASEYPGHTLIGADAGELAGVGKLGVLVGGDAETTFRDAD 71

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDFS    TL  L ++       +IGTTGFS  E + I+  A   P+V + N ++G+N
Sbjct: 72  VVIDFSVVEATLAHLRLALAQGTPIVIGTTGFSAAERQQIALAAERIPVVFAPNYAVGVN 131

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  +    A  L    ++D EI+E HHR K+D+PSGTAL LG+AIA   + NL +  + 
Sbjct: 132 LLFKIAAEVAAVL--GGEYDIEIVEAHHRHKVDAPSGTALGLGQAIAEAVERNLDEVAIY 189

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R  Q  AR   +IG +++R G +VG+H+ +   +GE + L+H A  R  FA+G++ AA 
Sbjct: 190 GRQGQTGARDPQTIGFSTIRGGDVVGDHTAMFMTDGERLELTHRASSRMTFAKGAVRAAK 249

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   Q PGLY MRD+LG 
Sbjct: 250 WVVEQKPGLYDMRDILGF 267


>gi|319776251|ref|YP_004138739.1| dihydrodipicolinate reductase [Haemophilus influenzae F3047]
 gi|329123390|ref|ZP_08251954.1| dihydrodipicolinate reductase [Haemophilus aegyptius ATCC 11116]
 gi|317450842|emb|CBY87066.1| dihydrodipicolinate reductase [Haemophilus influenzae F3047]
 gi|327470972|gb|EGF16427.1| dihydrodipicolinate reductase [Haemophilus aegyptius ATCC 11116]
          Length = 270

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKVAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E+LE HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVLEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|226196817|ref|ZP_03792396.1| dihydrodipicolinate reductase [Burkholderia pseudomallei Pakistan
           9]
 gi|225931077|gb|EEH27085.1| dihydrodipicolinate reductase [Burkholderia pseudomallei Pakistan
           9]
          Length = 251

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 148/252 (58%), Gaps = 3/252 (1%)

Query: 20  LIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGIIDFS 79
           LI+ +   P  TL   + R+GSP +GQD G F+G    G+  +D++       D +IDF+
Sbjct: 2   LIEAVLAAPDATLAGALDRTGSPQLGQDAGAFLG-KQTGVALTDDIERVCAEADYLIDFT 60

Query: 80  SPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFLGFLV 139
            P  TL  L+ + +H++  +IGTTGFS  +   + +      +V S+NMS+G+N    L+
Sbjct: 61  RPEGTLAHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGGKIALVFSANMSVGVNVTMKLL 120

Query: 140 ETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNRHIQQ 199
           E AA+    A+ +D EI+E HHR K+D+PSGTAL++GE IA      L D  V  RH   
Sbjct: 121 EFAAKQF--AQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATGRTLDDCAVYGRHGVT 178

Query: 200 CARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWAKSQI 259
             R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +A+G+L AA +     
Sbjct: 179 GERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSYAQGALRAARFLAGHQ 238

Query: 260 PGLYSMRDVLGI 271
            G + M+DVLG+
Sbjct: 239 AGFFDMQDVLGL 250


>gi|261378102|ref|ZP_05982675.1| dihydrodipicolinate reductase [Neisseria cinerea ATCC 14685]
 gi|269145554|gb|EEZ71972.1| dihydrodipicolinate reductase [Neisseria cinerea ATCC 14685]
          Length = 269

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      +
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIQAAGEKTGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|225677390|ref|ZP_03788358.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590566|gb|EEH11825.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 261

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 155/268 (57%), Gaps = 13/268 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+ V+G  GRMG+ ++ E+  N  + +   + RSGS  I  D+G    I+ +GIK + +
Sbjct: 3   IRVGVIGCLGRMGKKILNELITNTKVEIAGAVARSGSKYIDSDIGPI--IANLGIKVTSS 60

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           ++   +  D +IDF++    L  L  + +     + GTTG    E   +  +A   PI+ 
Sbjct: 61  ISGIFELSDVVIDFTTKECMLDCLKAAVKFKTPLVSGTTGI---EGVDLKEYAAEVPILW 117

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S+NMS+G+N L  LV+ AAE L    ++D EI EMHH  K DSPSGTA+ LG+ IAN  K
Sbjct: 118 SANMSVGVNVLLKLVKKAAELL--GNEYDVEIWEMHHNLKKDSPSGTAIELGKTIANASK 175

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V+   +  L  H     R +G IG A  R G ++G+HSV+     E I L+H A DR  F
Sbjct: 176 VDFQSNQYL--HSGSNIRKKGGIGFAVSRGGGVIGDHSVMFVNSDERIELNHKAIDRTTF 233

Query: 245 ARGSLTAALWA---KSQIPGLYSMRDVL 269
           ARG++ AA+W    K +IPGLYSM+DV+
Sbjct: 234 ARGAVQAAVWLYENKREIPGLYSMQDVI 261


>gi|315497109|ref|YP_004085913.1| dihydrodipicolinate reductase [Asticcacaulis excentricus CB 48]
 gi|315415121|gb|ADU11762.1| dihydrodipicolinate reductase [Asticcacaulis excentricus CB 48]
          Length = 250

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 155/275 (56%), Gaps = 34/275 (12%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           + +R +V G  GRMGQA+I+ ++    I                          +   F 
Sbjct: 2   TQIRFAVAGARGRMGQAVIRVLNERELI--------------------------VATTFD 35

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHN------IVHIIGTTGFSVKENEVISSF 116
              A+ +   D +IDF++PA TL      A+        + HIIG+TGF  ++   + ++
Sbjct: 36  KGDAIDLSQADAVIDFTTPAATLALAEACAEEGQRRAKPLAHIIGSTGFMPEQIAALEAY 95

Query: 117 ARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLG 176
                +++S N SLG+N L  LV  AA  L P   WD E+LE HH+RK+D+PSGTAL+LG
Sbjct: 96  GSRNILLRSGNFSLGVNMLMGLVRQAAAKLGP-DAWDIEVLEAHHKRKVDAPSGTALMLG 154

Query: 177 EAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSH 236
           +A A+GR VNL +  V  R      R  G+IG + +R G I+GEHSV+ A E E ITLSH
Sbjct: 155 DAAADGRGVNLNEVRVAARDGLTGQREPGTIGFSVIRGGGIIGEHSVLFAAEDEVITLSH 214

Query: 237 SAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           SA DR +FARG++ AALWA +Q PGLY M+DVLG 
Sbjct: 215 SARDRTLFARGAVEAALWAAAQSPGLYDMQDVLGF 249


>gi|120613186|ref|YP_972864.1| dihydrodipicolinate reductase [Acidovorax citrulli AAC00-1]
 gi|120591650|gb|ABM35090.1| dihydrodipicolinate reductase [Acidovorax citrulli AAC00-1]
          Length = 284

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 158/270 (58%), Gaps = 5/270 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPS-ITLHSIIVRSGSPLIGQDVGNFVGISPMGIKF 61
           +P+R++V G  GRMG+ LI+ +  + S + L   +   GSP +G D   F+G +  G+  
Sbjct: 16  APIRVAVAGASGRMGRMLIEALRGSGSELVLAGALDVPGSPSLGTDAEAFLGHAS-GVAV 74

Query: 62  SDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           + +L   +   D +IDF+ P  TL  L + A+  +  +IGTTGF+  +   I +FA+   
Sbjct: 75  TADLHEGLAGCDVLIDFTRPEGTLAHLAVCAERGVKAVIGTTGFTEAQKAEIEAFAQRTA 134

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           +V + NMS+G+N    L+E AA  L  +  +D EI+E HHR K+D+PSGTAL +GE IA 
Sbjct: 135 VVMAPNMSVGVNVTFKLLEMAARAL--STGYDIEIIEAHHRHKVDAPSGTALKMGEVIAQ 192

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
               +L D  V  R      R   +IG A++R G IVG+H+V+ AG GE I +SH +  R
Sbjct: 193 ALGRDLKDCAVYGREGLTGERDPSTIGFAAVRGGDIVGDHTVLFAGTGERIEISHKSSSR 252

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             +A+GSL AA +  +   GL+ M DVLG+
Sbjct: 253 SGYAQGSLRAARFLAAHRTGLFDMFDVLGL 282


>gi|262274897|ref|ZP_06052708.1| dihydrodipicolinate reductase [Grimontia hollisae CIP 101886]
 gi|262221460|gb|EEY72774.1| dihydrodipicolinate reductase [Grimontia hollisae CIP 101886]
          Length = 268

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 152/267 (56%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +RI++ G  GRMG+ LI+ I       L +   R  S LIG D G   GI    +   D+
Sbjct: 2   VRIAIAGAAGRMGRQLIQAIDAMDGAVLTAASERPESSLIGTDAGELAGIGKRDVSIVDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA      D IIDF++P  TL +L +  ++    +IGTTGF+  +   I + A N  IV 
Sbjct: 62  LAKVADQFDVIIDFTAPVATLANLELCREYGKRLVIGTTGFTDAQRAQIDA-ATNVGIVM 120

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTA+ +GEAIA    
Sbjct: 121 APNYSVGVNLVFKLLEKAAKVM--GGYCDIEIVEAHHRHKVDAPSGTAIGMGEAIAGAMG 178

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L+D  V  R      R+   IG A++RAG IVGEH+ + A  GE + ++H A +R  F
Sbjct: 179 NKLSDVAVYAREGITGERSRDEIGFATIRAGDIVGEHTAIFADIGERVEITHKASNRMTF 238

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA+W  S+  G Y+M+DVL +
Sbjct: 239 ANGAVRAAIWLASKEAGFYTMQDVLAL 265


>gi|148826996|ref|YP_001291749.1| dihydrodipicolinate reductase [Haemophilus influenzae PittGG]
 gi|166222638|sp|A5UF10|DAPB_HAEIG RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|148718238|gb|ABQ99365.1| dihydrodipicolinate reductase [Haemophilus influenzae PittGG]
          Length = 270

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|194434565|ref|ZP_03066823.1| dihydrodipicolinate reductase [Shigella dysenteriae 1012]
 gi|194417218|gb|EDX33329.1| dihydrodipicolinate reductase [Shigella dysenteriae 1012]
 gi|332097947|gb|EGJ02920.1| dihydrodipicolinate reductase [Shigella dysenteriae 155-74]
          Length = 273

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 152/271 (56%), Gaps = 5/271 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           MH + +R+++ G GGRMG+ LI+       + L + + R GS L+G D G   G    G+
Sbjct: 1   MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L       D  IDF+ P  TL  L    QH    +IGTTGF     + I   A +
Sbjct: 61  TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IAIVFAANFSVGVNVMLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA+    +L D  V +       R  G+IG A++RAG IVGEH+ + A  GE + ++H A
Sbjct: 178 IAHALDKDLKDCAVYSCEGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
             R  FA G++ +ALW   +  GL+ MRDVL
Sbjct: 238 SSRMTFANGAVRSALWLSGKESGLFDMRDVL 268


>gi|218508739|ref|ZP_03506617.1| dihydrodipicolinate reductase protein [Rhizobium etli Brasil 5]
          Length = 256

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 155/270 (57%), Gaps = 19/270 (7%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++++V G  GRMG+A++  +  +P               IG++  +  G+        
Sbjct: 3   TPIKVAVAGANGRMGRAILSLLPADPDFAFVG--------GIGREAADGAGLI------- 47

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHN-IVHIIGTTGFSVKENEVISSFARNAP 121
            + + A+ + D I+DF++ A   +   + A       +IG TGF  +E E I+  AR+ P
Sbjct: 48  -DRSAAMAAADVILDFTTGAAAAELAGLCAAAGGPALVIGATGFEPEELERIAKAARSIP 106

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           I++S N S+G+N L  LV  AA  L PA  WD EILE HH RK+D+PSGTAL+LGEA A 
Sbjct: 107 ILRSGNFSIGVNMLVGLVTQAARAL-PAHGWDIEILEAHHNRKIDAPSGTALMLGEAAAE 165

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR V+L       R      R  G IG A LRAG +VGEH V+ A   E +TLSHSA DR
Sbjct: 166 GRGVSLASVERRGRDGITGVRPPGEIGFAVLRAGGLVGEHKVLFAAAEEVLTLSHSALDR 225

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +FARG+L AA W   + PG Y+MRDVLG+
Sbjct: 226 GMFARGALAAARWIVGRAPGEYNMRDVLGL 255


>gi|145641680|ref|ZP_01797257.1| dihydrodipicolinate reductase [Haemophilus influenzae R3021]
 gi|145273727|gb|EDK13596.1| dihydrodipicolinate reductase [Haemophilus influenzae 22.4-21]
          Length = 270

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKAAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|293610456|ref|ZP_06692756.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826800|gb|EFF85165.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325123978|gb|ADY83501.1| dihydrodipicolinate reductase [Acinetobacter calcoaceticus PHEA-2]
          Length = 273

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 158/272 (58%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRTLIQAVQQ-AGYQLAAAVERPESSLVGTDAGELAGIGSVGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S NLA  ++  D IIDF++P  T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVSGNLAEVLKDCDVIIDFTAPVATAQHLKLCREAGVAMVIGTTGMSDEQKAELDEVATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|94311906|ref|YP_585116.1| dihydrodipicolinate reductase [Cupriavidus metallidurans CH34]
 gi|166222668|sp|Q1LJ29|DAPB_RALME RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|93355758|gb|ABF09847.1| dihydrodipicolinate reductase [Cupriavidus metallidurans CH34]
          Length = 265

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 159/267 (59%), Gaps = 4/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG+ LI+ + N   +TL   +   G+  +GQD G F+G    GIK S +
Sbjct: 1   MKIAIAGASGRMGRMLIETVLNTDGVTLAGALDVPGAAALGQDAGLFLG-RETGIKISSD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   + + D +IDF+ P  TL  L ++ +     +IGTTGF     + ++  A++  +V 
Sbjct: 60  IEAVLSAADCLIDFTRPEGTLAHLAVAKRLGKKMVIGTTGFDAAGKQALADAAKSIGVVF 119

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++NMS+G+N    L+E AA+ L  +  +D EI+E HHR K+D+PSGTAL +GE +A    
Sbjct: 120 AANMSVGVNATFKLLEVAAKLL--STGYDIEIIEAHHRHKVDAPSGTALAMGEVVAKAIG 177

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      R   SIG A++R G IVG+H+V+ AG GE I +SH +  R+ +
Sbjct: 178 RDLDECAVYAREGHTGPRDAKSIGFATVRGGDIVGDHTVMFAGIGERIEISHKSSSRQSY 237

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA +   +  G++ M+DVLG+
Sbjct: 238 ADGAVRAARFLADKPSGMFDMQDVLGL 264


>gi|149908715|ref|ZP_01897376.1| dihydrodipicolinate reductase [Moritella sp. PE36]
 gi|149808257|gb|EDM68196.1| dihydrodipicolinate reductase [Moritella sp. PE36]
          Length = 272

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 160/268 (59%), Gaps = 6/268 (2%)

Query: 5   PMRISVLG-GGRMGQALIKEIHN-NPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
            +RI+V+G  GRMG+ +++ I + + +  + + I R     +G DVG   G+  +G+K  
Sbjct: 4   AVRIAVMGCNGRMGRTILEAIQDSDGAAIVGAAIERPECNFLGADVGELAGLGSLGVKVV 63

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +LA  +   D I+DF++P  TLQ L  +  ++   +IGTTGFS ++ ++I        +
Sbjct: 64  SSLADVVNDFDVIVDFTAPEATLQHLEFAVANHKKIVIGTTGFSDEQKQLIHDAGNTTGV 123

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           V + NMS+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE IAN
Sbjct: 124 VFAPNMSVGVNVMFKLLEMAAKVM---GDYTDIEIIEGHHRYKVDAPSGTALGMGEVIAN 180

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
               +L    V  R      R   +IG +++RAG +VGEH+ + A  GE I ++H A  R
Sbjct: 181 TLGRDLKKVAVYGREGNTGERDRETIGFSTIRAGDLVGEHTAMFADIGERIEITHKASSR 240

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVL 269
             FA+G++ A+ W  +Q  GLY+M+DVL
Sbjct: 241 MTFAKGAIRASTWVFAQEQGLYTMQDVL 268


>gi|209549832|ref|YP_002281749.1| dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535588|gb|ACI55523.1| Dihydrodipicolinate reductase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 256

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 155/268 (57%), Gaps = 21/268 (7%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P++I+V G  GRMG+A++  +  +P+  +   I R GS  IG+ +               
Sbjct: 4   PIKIAVAGANGRMGRAILPLLAADPAFAVVGGIARPGS--IGEGL--------------I 47

Query: 64  NLAMAIQSVDGIIDFSS--PALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           + A AI + D I+DF++   A  L  L  SA    + +IG TGF   E E I+  A   P
Sbjct: 48  DRAAAIAAADVILDFTTGRAAAELAGLCASAGGPAL-VIGATGFEPDELERIAEAAHKIP 106

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           I++S N S+G+N L  LV  AA  L PA+ WD EILE HH RK+D+PSGTAL+LGEA A 
Sbjct: 107 ILRSGNFSIGLNMLLGLVAQAARAL-PAQGWDIEILEAHHNRKIDAPSGTALMLGEAAAQ 165

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR V+L       R      R  G IG A LRAG +VGEHSV+ A   E +TLSHSA DR
Sbjct: 166 GRGVSLASVERRGRDGITGERRPGEIGFAVLRAGGLVGEHSVLFAAAEEVVTLSHSALDR 225

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVL 269
            +FARG+L AA W   +  G YSM+DVL
Sbjct: 226 GMFARGALAAARWVAGRTAGEYSMQDVL 253


>gi|207721576|ref|YP_002252015.1| dihydrodipicolinate reductase (dhpr) protein [Ralstonia
           solanacearum MolK2]
 gi|207744313|ref|YP_002260705.1| dihydrodipicolinate reductase (dhpr) protein [Ralstonia
           solanacearum IPO1609]
 gi|206586737|emb|CAQ17322.1| dihydrodipicolinate reductase (dhpr) protein [Ralstonia
           solanacearum MolK2]
 gi|206595718|emb|CAQ62645.1| dihydrodipicolinate reductase (dhpr) protein [Ralstonia
           solanacearum IPO1609]
          Length = 252

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 150/256 (58%), Gaps = 4/256 (1%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MGQ LI  +   P +TL + + R+GS  +GQD G  +G    G+  +D++   +   D +
Sbjct: 1   MGQMLIDTVLRTPGVTLAAALDRAGSDAVGQDAGAKLG-KATGVIITDDVRAGLSQADVL 59

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF+ P  TL  L I+ +  +  +IGTTGF+ ++      +     +V + NMS+G+N  
Sbjct: 60  IDFTRPEATLAHLEIARELGVGVVIGTTGFTAEQKASFKGYGTAIGVVWAPNMSVGVNAT 119

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             L+E AA+ L  A+ +D EI+E HH+ K+D+PSGTAL +GE +A  +   L +  V  R
Sbjct: 120 FKLIEVAAKIL--AQGYDVEIIEAHHKHKIDAPSGTALKMGEVVAEAQGTALAERAVYAR 177

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
                 R  G+IG A++R G IVG+H+V+  GEGE I ++H +  R+ +A G++ AA + 
Sbjct: 178 EGDTGPRVNGTIGFATVRGGDIVGDHTVLFIGEGERIEITHRSNSRQSYAEGAVRAACFL 237

Query: 256 KSQIPGLYSMRDVLGI 271
             +  GL+ M DVLG+
Sbjct: 238 AGK-KGLFDMNDVLGL 252


>gi|317402172|gb|EFV82763.1| dihydrodipicolinate reductase [Achromobacter xylosoxidans C54]
          Length = 263

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 152/267 (56%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI++ G  GRMGQ LI  +     + L   + R GSP +GQD G  +G    G+  +D+
Sbjct: 1   MRIAIAGASGRMGQMLIDAVLKADGLQLAVALDRQGSPSLGQDAGAPLG-QQTGVAITDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           LA A+ + D +IDF+ P  TL+ L   A+  +  +IGTTGF       I   A+   IV 
Sbjct: 60  LA-ALANADCLIDFTRPEGTLEHLQACARLGVKAVIGTTGFDDNGRAAIEVAAQKTAIVF 118

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L++ AA  L     +D E+ E HHR K+D+PSGTAL +GE IA+   
Sbjct: 119 APNMSVGVNATLKLLDMAARIL--NSGYDVEVFEAHHRNKVDAPSGTALKMGETIASAWD 176

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D    +RH     R  G+IG + LR G IVG+H+V   G GE I ++H +  R  +
Sbjct: 177 VALPDVATWSRHGDTGVRKPGTIGFSVLRGGDIVGDHTVSFCGIGERIEITHRSASRATY 236

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AA + + +  GLY M+ VLG+
Sbjct: 237 AEGALRAARFLEGKHNGLYDMQAVLGL 263


>gi|86358200|ref|YP_470092.1| dihydrodipicolinate reductase protein [Rhizobium etli CFN 42]
 gi|86282302|gb|ABC91365.1| dihydrodipicolinate reductase protein [Rhizobium etli CFN 42]
          Length = 248

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 127/201 (63%), Gaps = 4/201 (1%)

Query: 73  DGIIDFSS--PALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSL 130
           D I+DF++   A  L  L  SA    + +IG TGF  +E + I++ AR  PI++S N S+
Sbjct: 42  DVILDFTTGNAAAELAGLCASAGGPAL-VIGATGFEPEEIQRIAAAARTIPILRSGNFSI 100

Query: 131 GINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDH 190
           G+N L  LV  AA  L PA  WD EILE HH RK+D+PSGTAL+LGEA A GR V+L   
Sbjct: 101 GVNILVGLVAQAARAL-PAHGWDIEILEAHHNRKIDAPSGTALMLGEAAAEGRGVSLASV 159

Query: 191 MVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLT 250
               R      R  G IG A LRAG +VGEHSV+ A   E +TLSHSA DR +FARG+L 
Sbjct: 160 ERRRRDGVTGERPAGEIGFAVLRAGGLVGEHSVLFAAADEVVTLSHSALDRGMFARGALA 219

Query: 251 AALWAKSQIPGLYSMRDVLGI 271
           AA W   + PG YSMRDVLG+
Sbjct: 220 AARWIAGRAPGEYSMRDVLGL 240


>gi|169794239|ref|YP_001712032.1| dihydrodipicolinate reductase [Acinetobacter baumannii AYE]
 gi|213158765|ref|YP_002321186.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB0057]
 gi|215481797|ref|YP_002323979.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB307-0294]
 gi|301345897|ref|ZP_07226638.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB056]
 gi|301509964|ref|ZP_07235201.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB058]
 gi|301594542|ref|ZP_07239550.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB059]
 gi|332850317|ref|ZP_08432651.1| dihydrodipicolinate reductase [Acinetobacter baumannii 6013150]
 gi|332871575|ref|ZP_08440069.1| dihydrodipicolinate reductase [Acinetobacter baumannii 6013113]
 gi|226724125|sp|B7GV10|DAPB_ACIB3 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|226724126|sp|B7I2B0|DAPB_ACIB5 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238688082|sp|B0VA26|DAPB_ACIBY RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|169147166|emb|CAM85025.1| dihydrodipicolinate reductase [Acinetobacter baumannii AYE]
 gi|213057925|gb|ACJ42827.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB0057]
 gi|213987208|gb|ACJ57507.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB307-0294]
 gi|332730775|gb|EGJ62085.1| dihydrodipicolinate reductase [Acinetobacter baumannii 6013150]
 gi|332731429|gb|EGJ62721.1| dihydrodipicolinate reductase [Acinetobacter baumannii 6013113]
          Length = 273

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 161/272 (59%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + +VR  S LIG D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRILIQAVQQ-AGYQLGAAVVRPESTLIGADAGELAGIGSIGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K + +LA  ++  D +IDFS+PA T + L +  +  +  +IGTTG S ++   +   A++
Sbjct: 59  KLTGSLAEVLEDCDVVIDFSTPAATSEHLKLCREAGVAIVIGTTGMSDEQKAELDETAKH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 IPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|121596208|ref|YP_988104.1| dihydrodipicolinate reductase [Acidovorax sp. JS42]
 gi|120608288|gb|ABM44028.1| dihydrodipicolinate reductase [Acidovorax sp. JS42]
          Length = 273

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 156/269 (57%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P R++V G  GRMG+ LI+ I  +    L   + + G+P +G D   F+G +  G+  +
Sbjct: 7   APRRVAVAGASGRMGRMLIEAIQASDGCVLAGALDQPGNPAVGTDAAAFLGRAS-GVVIT 65

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L   ++  D +IDF+ P  TL  L + A+  +  +IGTTGFS  +   I + A+   +
Sbjct: 66  ADLREGLKDADVLIDFTRPEGTLAHLAVCAELGVQMVIGTTGFSDAQKVQIEAAAQKVGV 125

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L++ AA+ L     +D EI+E HH+ K+D+PSGTAL +GE IA  
Sbjct: 126 VFAPNMSVGVNVTLKLLQMAAQALRTG--YDIEIIEAHHKHKVDAPSGTALKMGEVIAEA 183

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
           +   L D  V  R+     R   +IG A++R G IVG+H+V+ AG GE + +SH +  R 
Sbjct: 184 QGTRLADRAVYERYGHTGERKADTIGFATVRGGDIVGDHTVLFAGTGERVEISHKSSSRA 243

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+GSL A  +  +Q  GL+ M DVL +
Sbjct: 244 GYAQGSLRAVGFLATQRAGLFDMFDVLNL 272


>gi|291278648|ref|YP_003495483.1| dihydrodipicolinate reductase [Deferribacter desulfuricans SSM1]
 gi|290753350|dbj|BAI79727.1| dihydrodipicolinate reductase [Deferribacter desulfuricans SSM1]
          Length = 268

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 151/269 (56%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S   I ++G  G+MG+ +I    ++  I +   +    S  +G+D+G  +G+  +G+K S
Sbjct: 2   SKTAICMVGAAGKMGRRIIALGLDDNDIEIGGAVESKESSFLGKDIGEVIGVGNLGVKIS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           DN+    +  D +IDF+    TL +L+   +     +IGTTGF   E E I   +   P+
Sbjct: 62  DNIVETAKDSDVLIDFTFKTATLSNLDAYLEAGKPIVIGTTGFEDSEVEEIKKLSEKIPV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           + + NMSLG+N    ++E  A+ +     +D EI+E HHR K D+PSGTA+ + E +A  
Sbjct: 122 LLAPNMSLGVNLTFKVLEMVAKAI--GNIYDIEIIEAHHRMKKDAPSGTAMKMAEVVAKA 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              NL    V  R      RT+  IGI ++RAG IVGEH+V+  G GE I ++H A+ R 
Sbjct: 180 TGRNLDSDAVYCRRGLIGERTDKEIGIQTIRAGDIVGEHTVMFCGNGERIEITHKAHTRD 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA+G+L+AA W K +  G YSM DVL +
Sbjct: 240 TFAKGALSAAKWIKDKPAGFYSMFDVLNL 268


>gi|183220146|ref|YP_001838142.1| dihydrodipicolinate reductase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910266|ref|YP_001961821.1| dihydrodipicolinate reductase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774942|gb|ABZ93243.1| Dihydrodipicolinate reductase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778568|gb|ABZ96866.1| Dihydrodipicolinate reductase (DHPR) [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 267

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 159/269 (59%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S +++ V+G GGRMG+A+I+ +  +    L + +VR G+   G D GN  GI   GI  S
Sbjct: 2   SKIKVGVIGAGGRMGKAIIQVLSLSKKSELSAAVVREGAIYAGFDSGNHAGIKETGILLS 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +L  A +  D +IDFS+       LN + Q++   +IGTTG +  +  +I S A+  PI
Sbjct: 62  SDLQKACEGSDVLIDFSTHTGFESILNAALQNHKPLVIGTTGLTDSDKTLIQSAAKTIPI 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V S NMS+G+N L  L E AA+ L   +D+D E+L++HHR K D+PSGTA+ L E +   
Sbjct: 122 VFSPNMSVGVNLLFKLTEIAAKVL--HEDFDIEVLDIHHRHKKDAPSGTAMYLKEVLLGA 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
            K +  ++++  RH     R +  I + ++RAG +VGEH+V      E I ++H A DR+
Sbjct: 180 SKRS-EENVIYGRHGMYPERDQKEIAMHTMRAGEVVGEHTVYFFSPEERIEITHRAQDRK 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA +   +  GLY+M DVLGI
Sbjct: 239 TFASGAVKAAEFLHGKSKGLYNMFDVLGI 267


>gi|58584437|ref|YP_198010.1| dihydrodipicolinate reductase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75498038|sp|Q5GTA6|DAPB_WOLTR RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|58418753|gb|AAW70768.1| Dihydrodipicolinate reductase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 264

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 158/269 (58%), Gaps = 12/269 (4%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISP-MGIKFSD 63
           +++ V+G  GRMG+ ++ E+  N  + +   + R GS  IG D+G+ V  S  +GIK + 
Sbjct: 3   IKVGVIGCSGRMGKRILNELITNTQVEIAGAVARLGSKYIGSDIGSAVYHSSNLGIKVTS 62

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +++   +S D +IDF++    L  L  + +     + GTTG    E+  +  +A   PI+
Sbjct: 63  SISDVFESSDVVIDFTTKECMLACLKAAMKFKTPLVSGTTGI---ESINLKKYAAKIPIL 119

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            S+NMS+G+N L  LV+ AAE+L    ++D EI EMHH  K DSPSGTA+  G+AIAN  
Sbjct: 120 WSANMSVGVNVLLKLVKKAAEFL--DNEYDVEIWEMHHNLKKDSPSGTAMEFGKAIANAL 177

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
           KV+   +   + H     R +G IG A  R G +VG+HSV+     E I L+H A DR  
Sbjct: 178 KVDFQPYQ--HSHNSSNIREKGKIGFAVSRGGGVVGDHSVMFINSDERIELNHKAIDRTT 235

Query: 244 FARGSLTAALWA---KSQIPGLYSMRDVL 269
           FARG++ AA+W    K + PGLYSM+DV+
Sbjct: 236 FARGAVRAAIWLYENKRETPGLYSMQDVI 264


>gi|225077516|ref|ZP_03720715.1| hypothetical protein NEIFLAOT_02579 [Neisseria flavescens
           NRL30031/H210]
 gi|224951136|gb|EEG32345.1| hypothetical protein NEIFLAOT_02579 [Neisseria flavescens
           NRL30031/H210]
          Length = 269

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 156/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S ++I++ G  GRMG+ L++ ++N+P   L   +  SGS ++G D G   G+   G+  S
Sbjct: 2   SALKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEVLGLDAGFASGLK-TGVTIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      +
Sbjct: 61  DDVDAVLDQSDVLIDFTRPEPTLKHLQKCVEKGVNIIIGTTGFDDAGKAAIQAAGEKTGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA+ 
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIADA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKECAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+WA  +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWANGK-KGLYDMQDVLGL 266


>gi|294085180|ref|YP_003551940.1| dihydrodipicolinate reductase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664755|gb|ADE39856.1| Dihydrodipicolinate reductase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 275

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 156/270 (57%), Gaps = 9/270 (3%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +++S+ GG GRMG  LI+EI     + LH+   R  SPLIG+D G   GI   G+  + +
Sbjct: 7   IKLSIPGGSGRMGNMLIREIAAASDLVLHATSDRPESPLIGKDSGELAGIGANGVMINSD 66

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
            A A+   D ++DF+SPA++L    ++ Q+N+  +IGTTG    +   ++      P+V 
Sbjct: 67  PA-ALVGGDVMVDFTSPAVSLAHAELAMQNNMAMVIGTTGLDASQEARLAEIGTKIPLVY 125

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
            +N S+G+  L  LVE  A  L+  + WD EILE HH  K+DSPSGTAL LG+A A GR 
Sbjct: 126 CANTSVGVTLLRALVEQVAAQLV--EGWDIEILETHHHHKVDSPSGTALALGKAAAKGRG 183

Query: 185 VNLTDHMVLNRHIQQCA-----RTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           V L D   + R  Q  A     R  G IG A +R G + GEHSV   G  E I L+H A 
Sbjct: 184 VALEDVSDIVRDDQAGASRVGARKAGDIGFAVMRGGDVTGEHSVTFFGASERIALTHMAT 243

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVL 269
           DR +FA+G++ AA +A +   G Y+M DVL
Sbjct: 244 DRVVFAKGAIRAARFAATADTGFYNMEDVL 273


>gi|260557795|ref|ZP_05830008.1| dihydrodipicolinate reductase [Acinetobacter baumannii ATCC 19606]
 gi|260408586|gb|EEX01891.1| dihydrodipicolinate reductase [Acinetobacter baumannii ATCC 19606]
          Length = 273

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 159/272 (58%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + I R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRTLIQAVQQ-AGYQLAAAIERPESSLVGTDAGELAGIGSVGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S +LA  ++  D IIDF++PA T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVSGSLADVLKDCDVIIDFTAPAATAQHLKLCREAGVAMVIGTTGMSDEQKAELDEAATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|16273220|ref|NP_439459.1| dihydrodipicolinate reductase [Haemophilus influenzae Rd KW20]
 gi|260581345|ref|ZP_05849161.1| dihydrodipicolinate reductase [Haemophilus influenzae RdAW]
 gi|1169218|sp|P45153|DAPB_HAEIN RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|1574767|gb|AAC22955.1| dihydrodipicolinate reductase (dapB) [Haemophilus influenzae Rd
           KW20]
 gi|260092012|gb|EEW75959.1| dihydrodipicolinate reductase [Haemophilus influenzae RdAW]
          Length = 270

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 147/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG  LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGCQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKVAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|71083072|ref|YP_265791.1| dihydrodipicolinate reductase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|90101248|sp|Q4FNQ1|DAPB_PELUB RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|71062185|gb|AAZ21188.1| Dihydrodipicolinate reductase [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 258

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 150/261 (57%), Gaps = 19/261 (7%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMGQ LIK   NN +  L ++   + +  I + +         GIK   N     +  D
Sbjct: 13  GRMGQQLIKSSKNNKNFKLTAL---TENKAISKKIA--------GIKLDVNTEQTFKKTD 61

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            IIDF+ P  TL  L I+++     +IGTTGF+ KE  +I  F++  PI+K+ NMSLG+N
Sbjct: 62  VIIDFTVPNCTLDILKIASKLKKRVVIGTTGFNQKEEALIKKFSKTIPILKAGNMSLGVN 121

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHM-- 191
            L +L E  ++ L   +++  ++ E+HH+ K D PSGTAL+LG+ IA+G+  NL + M  
Sbjct: 122 LLMYLTEITSKSL--NEEYLSKVFEVHHKHKKDYPSGTALMLGKGIADGKNKNLYNLMGK 179

Query: 192 -VLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLT 250
             LN+      +    I   S+R G I+GEH V  +   E I L+H A+DR +++ G+LT
Sbjct: 180 KFLNKKSFPYGK---KINFNSIRKGEIIGEHEVTFSSGKEIIKLNHEAFDRALYSDGALT 236

Query: 251 AALWAKSQIPGLYSMRDVLGI 271
           AA W  ++ PGLYSMRD+L  
Sbjct: 237 AAKWLINKKPGLYSMRDLLNF 257


>gi|329120298|ref|ZP_08248966.1| dihydrodipicolinate reductase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327462639|gb|EGF08962.1| dihydrodipicolinate reductase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 269

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ LI+ +  +P   L   I  SGS  +G D G  +G+   GI  S
Sbjct: 2   NPLKIAIAGANGRMGRVLIEAVEKHPDTVLGGAIEHSGSDALGLDAGFAIGLK-TGITIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D+    I   D +IDF+ P  TL+ L    +     +IGTTGF       I +      +
Sbjct: 61  DDADAVIAQSDVLIDFTRPEPTLRHLQKCVERGTNIVIGTTGFDDAGKAAIKAAGEKIGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IAN 
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEAHHRHKVDAPSGTALRMGEVIANA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R     AR   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKECAVYGREGHTGARDPNTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+WA+ +  GL+ M+DVLG+
Sbjct: 239 TFASGAVRAAVWARGK-KGLFDMQDVLGL 266


>gi|260553870|ref|ZP_05826138.1| dihydrodipicolinate reductase [Acinetobacter sp. RUH2624]
 gi|260404990|gb|EEW98492.1| dihydrodipicolinate reductase [Acinetobacter sp. RUH2624]
          Length = 273

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 161/272 (59%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + +VR  S LIG D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRILIQAVQQ-AGYQLGAAVVRPESTLIGADAGELAGIGSIGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K + +LA  ++  D +IDFS+PA T + L +  +  +  +IGTTG S ++   +   A++
Sbjct: 59  KLTGSLAEVLKDCDVVIDFSTPAATSEHLKLCREAGVAIVIGTTGMSDEQKAELDETAKH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 IPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREAHKYDMKDVLGL 268


>gi|184159959|ref|YP_001848298.1| dihydrodipicolinate reductase [Acinetobacter baumannii ACICU]
 gi|239502764|ref|ZP_04662074.1| dihydrodipicolinate reductase [Acinetobacter baumannii AB900]
 gi|238685543|sp|A3MA87|DAPB_ACIBT RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238691019|sp|B2I2G4|DAPB_ACIBC RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|183211553|gb|ACC58951.1| Dihydrodipicolinate reductase [Acinetobacter baumannii ACICU]
 gi|193078757|gb|ABO13831.2| dihydrodipicolinate reductase [Acinetobacter baumannii ATCC 17978]
 gi|322509875|gb|ADX05329.1| Dihydrodipicolinate reductase [Acinetobacter baumannii 1656-2]
          Length = 273

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 159/272 (58%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRTLIQAVQQ-AGYQLAAAVERPESSLVGTDAGELAGIGSVGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S +LA  ++  D IIDF++PA T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVSGSLADVLKDCDVIIDFTAPAATAQHLKLCREAGVAMVIGTTGMSDEQKAELDEAATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|68249968|ref|YP_249080.1| dihydrodipicolinate reductase [Haemophilus influenzae 86-028NP]
 gi|81335608|sp|Q4QKM7|DAPB_HAEI8 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|68058167|gb|AAX88420.1| dihydrodipicolinate reductase [Haemophilus influenzae 86-028NP]
          Length = 270

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  +L+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGSLEHIAFCVANNKKMVIGTTGFDQNGKAAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|308050596|ref|YP_003914162.1| dihydrodipicolinate reductase [Ferrimonas balearica DSM 9799]
 gi|307632786|gb|ADN77088.1| dihydrodipicolinate reductase [Ferrimonas balearica DSM 9799]
          Length = 270

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 153/267 (57%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R+++ G  GRMG+ LI+   +N  I L + I R GS L+G D G  V    +G+   D+
Sbjct: 4   IRVAITGASGRMGRTLIEAAIDNDGIELGAAIERPGSTLMGVDAGELVARGKLGVSLVDS 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +   +   D +IDF+SP  +L+ L     +    +IGTTGFS ++   I+  A+  P+V 
Sbjct: 64  IDKVMDQFDVLIDFTSPESSLEFLAKCQANGKAVVIGTTGFSDEQKAQIAEVAQGLPVVL 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NM++G+N +  L+E AAE +      D EI+E HHR K D+PSGTAL +GE IA+  K
Sbjct: 124 APNMAVGVNLMFKLLEVAAEVM--GHYTDIEIIEGHHRYKKDAPSGTALKMGEVIADTLK 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    +  R      R   +I  +++RAG IVGEH+ + A  GE + ++H A  R  F
Sbjct: 182 RDLKTCAIYGREGITGERERDTIAFSTIRAGDIVGEHTALFADIGERLEITHKASSRMTF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA +   Q  GLY M+ VLG+
Sbjct: 242 ANGAMRAARFLAQQPVGLYDMQQVLGL 268


>gi|291288392|ref|YP_003505208.1| dihydrodipicolinate reductase [Denitrovibrio acetiphilus DSM 12809]
 gi|290885552|gb|ADD69252.1| dihydrodipicolinate reductase [Denitrovibrio acetiphilus DSM 12809]
          Length = 268

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 90/269 (33%), Positives = 155/269 (57%), Gaps = 3/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S ++I+++G  G+MG+ +I  I  +    L+  +  S  P +G D G+  G   + ++ +
Sbjct: 2   SKVKIAMVGAAGKMGRRIISLITEDERCELNGALEHSACPFLGHDAGDVAGCGKLSVEIT 61

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++  A    D  IDF+    T+ +L+   +  +  +IG+TG + ++ + +   +   P+
Sbjct: 62  DDIDKAFDGCDVFIDFTGAEPTMANLSRFQKAGVPAVIGSTGMTTEQTKELEKLSSEMPV 121

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           + S NMS+G+N    ++E   + +   + WD EI+E HHR K D+PSGTA+ +GE IAN 
Sbjct: 122 LFSPNMSVGVNLTFKILEMVTQAI--GETWDIEIIEAHHRMKKDAPSGTAMRMGEVIANV 179

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              ++       RH     RT+  IG+ +LRAG IVGEH+ +    GE I ++H A+ R 
Sbjct: 180 LGRDIEKDGAFCRHGLIGERTDREIGMQTLRAGDIVGEHTAMFCTNGERIEITHRAHTRD 239

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +FA+G+++AA+W K +  G Y+M DVLG+
Sbjct: 240 MFAKGAISAAVWLKGRDNGFYNMFDVLGL 268


>gi|319639455|ref|ZP_07994205.1| dihydrodipicolinate reductase [Neisseria mucosa C102]
 gi|317399350|gb|EFV80021.1| dihydrodipicolinate reductase [Neisseria mucosa C102]
          Length = 269

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 157/269 (58%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S ++I++ G  GRMG+ L++ ++N+P   L   +  SGS ++G D G   G+   G+  S
Sbjct: 2   SALKIAIAGVNGRMGRVLVEAVNNHPDAVLSGALEHSGSEVLGLDAGFASGLK-TGVAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    + ++  IIGTTGF       I +      +
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKDVNIIIGTTGFDDAGKAAIQAAGEKIGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA+ 
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIADA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKECAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+WA  +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWANGK-KGLYDMQDVLGL 266


>gi|307132642|ref|YP_003884658.1| dihydrodipicolinate reductase [Dickeya dadantii 3937]
 gi|306530171|gb|ADN00102.1| dihydrodipicolinate reductase [Dickeya dadantii 3937]
          Length = 273

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 150/273 (54%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  + +R+++ G GGRMG+ LI+       + L + + R  S L+G D G   G     I
Sbjct: 1   MRDAQIRVAIAGAGGRMGRQLIQAALQMDGVALGAALEREDSSLLGSDAGELAGAGKTDI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
               +L   +   D  IDF+ P  TL  L    +H    +IGTTGF  +    I   A +
Sbjct: 61  TVQSSLEAVVDDFDVFIDFTRPEGTLSHLAFCRKHGKGMVIGTTGFDEQGKAAIQQAAAD 120

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEA 178
             IV ++N S+G+N L  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GEA
Sbjct: 121 IGIVFAANFSVGVNVLLKLLEKAAKVM---GDYTDIEIIEAHHRHKVDAPSGTALAMGEA 177

Query: 179 IANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSA 238
           IA     +L    V  R      R   SIG A++RAG IVGEH+ + A  GE I ++H A
Sbjct: 178 IAGALGRDLKQCAVYAREGYTGEREPKSIGFATIRAGDIVGEHTAMFADVGERIEITHKA 237

Query: 239 YDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
             R  FA G++ +ALW  S+  GL+ MRDVLG+
Sbjct: 238 SSRMTFANGAVRSALWVSSRNHGLFDMRDVLGL 270


>gi|298370327|ref|ZP_06981643.1| dihydrodipicolinate reductase [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281787|gb|EFI23276.1| dihydrodipicolinate reductase [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 268

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 156/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S ++I++ G  GRMG+ L++ ++N+P   L   +  +GS ++G D G   GI   GI  S
Sbjct: 2   SALKIAIAGVNGRMGRVLVEAVNNHPDTILSGALEHAGSEVLGLDAGFASGIK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I S +    +
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKGVNIIIGTTGFDDAGKAAIRSASEKTGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA+ 
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIADA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+WA  +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWANGK-TGLYDMQDVLGL 266


>gi|89899565|ref|YP_522036.1| dihydrodipicolinate reductase [Rhodoferax ferrireducens T118]
 gi|89344302|gb|ABD68505.1| dihydrodipicolinate reductase [Rhodoferax ferrireducens T118]
          Length = 271

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 153/266 (57%), Gaps = 4/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           R+++ G  GRMGQ LI+ I + P   L   +    SP +G D   F+G +  G+  + +L
Sbjct: 8   RVAIAGASGRMGQMLIEAIKSAPDCELTGALDVPTSPALGADAMAFLGQTS-GVAITADL 66

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
           A+ ++    +IDF+ P  TL  + +  +  +  +IGTTGFS  +   I++  R+  IV +
Sbjct: 67  AVGLKQARTLIDFTRPEGTLAHVRMCRELGVNVVIGTTGFSDAQKAEITAATRDIAIVMA 126

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N    L+E AA+ L  A  +D EI+E HHR K+D+PSGTAL +GE +A     
Sbjct: 127 PNMSVGVNVTLKLLEMAAKAL--ATGYDIEIIEAHHRHKVDAPSGTALKMGEVVAGALGR 184

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L D  V  R      R   SIG A++R G IVG+H+V+ AG GE I +SH +  R  +A
Sbjct: 185 DLKDCAVYARQGVTGERDPSSIGFATIRGGDIVGDHTVLFAGIGERIEISHKSSSRATYA 244

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +GSL A  +   Q  GLY M DVL +
Sbjct: 245 QGSLRALRFLSQQKAGLYDMADVLNL 270


>gi|327482038|gb|AEA85348.1| dihydrodipicolinate reductase [Pseudomonas stutzeri DSM 4166]
          Length = 297

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSIT-LHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           RI+V G  GRMG+ LI+ +     +  L + I R  S L+G D G    I  +G+  + +
Sbjct: 3   RIAVTGAAGRMGKTLIEAVQQTGGVAGLTAAIDRPDSTLVGADAGELAAIGRLGVPLTGD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +  A+   D +IDF+ P++TL++L +  +     +IGTTGFS +E E + + AR  PIV 
Sbjct: 63  VGKAVDEFDVLIDFTHPSVTLKNLEVCRRAGKAMVIGTTGFSPEEKERLVAAAREIPIVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S+G+N    L++TAA  L    D D EI+E HHR K+D+PSGTAL +GE +A    
Sbjct: 123 AANFSVGVNLCLKLLDTAARVL--GDDVDIEIIEAHHRHKVDAPSGTALRMGEVVAEALG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V  R  Q  AR   +IG A++RAG +VG+H+V+ A +GE + ++H A  R  F
Sbjct: 181 RDLQKVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAADGERVEITHKASSRMTF 240

Query: 245 ARGSL 249
           A G  
Sbjct: 241 ANGGC 245


>gi|153003229|ref|YP_001377554.1| dihydrodipicolinate reductase [Anaeromyxobacter sp. Fw109-5]
 gi|166222611|sp|A7H774|DAPB_ANADF RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|152026802|gb|ABS24570.1| Dihydrodipicolinate reductase [Anaeromyxobacter sp. Fw109-5]
          Length = 268

 Score =  178 bits (451), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 148/258 (57%), Gaps = 4/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG  +++ +     + L   + R G    GQD G   GI P+G+   D+LA A+   D
Sbjct: 11  GRMGTQIVRLVAAAEGLKLTGAVERPGH--AGQDAGALAGIPPLGVAVVDDLAGALAGAD 68

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+S   + ++  + A+  +  +IG+TGF+ +    +++ A   P+V S NMS+G+N
Sbjct: 69  VVIDFTSHEASARNAELCAEKGVALVIGSTGFTPEAKARVAAAAARIPVVFSPNMSVGVN 128

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV  AA+ L  A  +D EI+E+HH+RK D+PSGTA+ LGE  A     +  D +  
Sbjct: 129 VLFELVRQAAKVLGDA--YDVEIVEIHHKRKRDAPSGTAVALGEVAAGALGRDPADALAY 186

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            RH     R    IG+ +LR G +VGEH+V   GEGE + L+H A  R  FARG++ AA 
Sbjct: 187 TRHGILGERPPWQIGVQTLRGGDVVGEHTVYFCGEGERLELTHRATSREQFARGAVRAAG 246

Query: 254 WAKSQIPGLYSMRDVLGI 271
           +   +  GLY M DVLG+
Sbjct: 247 FIAGKPAGLYDMADVLGL 264


>gi|262376816|ref|ZP_06070043.1| dihydrodipicolinate reductase [Acinetobacter lwoffii SH145]
 gi|262308161|gb|EEY89297.1| dihydrodipicolinate reductase [Acinetobacter lwoffii SH145]
          Length = 273

 Score =  178 bits (451), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 151/272 (55%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +H      L + + R  S L+G D G   GI   G+
Sbjct: 1   MSATP-RIGILGAGGRMGRILIQAVHE-AGYQLAAAVERPESTLLGTDAGELAGIGATGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K   +L   ++  D +IDF++PA T+  L I  +  +  +IGTTG + ++   +   A  
Sbjct: 59  KVVGSLTDVVKDCDVVIDFTAPAATVNHLKICREAGVAIVIGTTGMNDEQKAYLDQSATE 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E A++        D E++E HHR K+D+PSGTAL+ GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELASKVF--GDTVDIEVIEAHHRHKVDAPSGTALMWGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L +  V  R      R   SIG  ++R G IVGEH+ +   +GE + ++H A 
Sbjct: 177 AETLGRDLKEDAVYCREGHTGPRERKSIGFQTIRGGDIVGEHTAMFIADGERVEITHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG 
Sbjct: 237 NRMNFASGAVRAAAWVVGREARKYDMKDVLGF 268


>gi|296134542|ref|YP_003641784.1| dihydrodipicolinate reductase [Thiomonas intermedia K12]
 gi|295794664|gb|ADG29454.1| dihydrodipicolinate reductase [Thiomonas intermedia K12]
          Length = 273

 Score =  178 bits (451), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 104/275 (37%), Positives = 155/275 (56%), Gaps = 7/275 (2%)

Query: 1   MHQSPM---RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISP 56
           M  SP    RI++ G  GRMG+ L++ +   P  ++ + +   GSP +GQD G F G+  
Sbjct: 1   MSTSPAETHRIAIAGASGRMGRTLVEAVLAAPDCSIGAALDMPGSPALGQDAGAFAGVH- 59

Query: 57  MGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSF 116
            G+    +L  A+Q V   IDF+ P  T+  L       +  +IGTTGF   +   I   
Sbjct: 60  TGVAIRSDLYAALQHVRYFIDFTRPEGTMAHLAACEAAGVAMVIGTTGFDEAQLARIRIA 119

Query: 117 ARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLG 176
           ++   IV + NMS+G+N +  L+E AA  L  A+ +D EI+E HHR K+D+PSGTAL +G
Sbjct: 120 SQRIAIVMAPNMSIGVNVVFKLLEQAARAL--AQGYDIEIIEAHHRHKVDAPSGTALKMG 177

Query: 177 EAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSH 236
           E +A     +L    V  R      R   +IG A++R G IVG+H+V+ AG GE I ++H
Sbjct: 178 EVVACALGRDLKQCAVYGREGVTGERDPSTIGFATVRGGDIVGDHTVLFAGTGERIEITH 237

Query: 237 SAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +  R  +A+GSL A  +  +Q  GL+ M+DVLG+
Sbjct: 238 KSSSRATYAQGSLRAVRFLAAQSHGLFDMQDVLGL 272


>gi|52425026|ref|YP_088163.1| dihydrodipicolinate reductase [Mannheimia succiniciproducens
           MBEL55E]
 gi|81609561|sp|Q65TY2|DAPB_MANSM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|52307078|gb|AAU37578.1| DapB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 270

 Score =  178 bits (451), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 152/267 (56%), Gaps = 5/267 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++++++G GGRMG+ LI+ +     + L +   R GS LIG D G   G+  +GIK ++
Sbjct: 2   TLKLAIVGAGGRMGRQLIQAVQAAEGVELGAAFERKGSSLIGADAGELAGLGELGIKVAE 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +LA      D IIDF+ P  +L+ +     +N   I+GTTGF     + I   A    IV
Sbjct: 62  DLAAEKDKFDIIIDFTRPEGSLEHIKFCVANNKKLILGTTGFDDAGKQAIGKAAEKTAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDW-DFEILEMHHRRKLDSPSGTALLLGEAIANG 182
            +SN S+G+N +  L+E AA+ +    D+ D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 122 FASNYSVGVNLVFKLLEKAAKVM---GDYSDIEIIEAHHRHKVDAPSGTALSMGEHIAKT 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L  + V +R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R 
Sbjct: 179 LGRDLKVNGVFSREGITGERKRTDIGFSTIRAADVVGEHTVWFADIGERVEISHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVL 269
            FA G++ AA W  ++  GL+ M DVL
Sbjct: 239 TFANGAVRAAKWLANKQIGLFDMTDVL 265


>gi|262280601|ref|ZP_06058385.1| dihydrodipicolinate reductase [Acinetobacter calcoaceticus RUH2202]
 gi|262258379|gb|EEY77113.1| dihydrodipicolinate reductase [Acinetobacter calcoaceticus RUH2202]
          Length = 273

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 158/272 (58%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI VLG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGVLGAGGRMGRTLIQAVQQ-AGYQLAAAVERPESSLVGTDAGELAGIGSVGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S +LA  ++  D IIDF++P  T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVSGSLAEILKDCDVIIDFTAPVATAQHLKLCREAGVAMVIGTTGMSDEQKAELDEVATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|15602591|ref|NP_245663.1| dihydrodipicolinate reductase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|13431431|sp|P57867|DAPB_PASMU RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|12721021|gb|AAK02810.1| DapB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 270

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 147/268 (54%), Gaps = 3/268 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            +R++++G GGRMG+ LI+ +     + L +   R GS L+G D G    +  +G++ +D
Sbjct: 2   TLRVAIVGAGGRMGRQLIQAVSETEGVVLGAAFERQGSSLLGADAGELANVGHLGVQITD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +LA      D +IDF+ P  TL  L      +   +IGTTGF       I   A +  IV
Sbjct: 62  DLASQQDQFDLLIDFTRPEGTLAHLAFCVAQHKNMVIGTTGFDDDGKAKIQQAADSIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG A++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKTHGVFTRDGITGERKRDEIGFATIRASDVVGEHSVWFADIGERVEIAHKATSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA+G++ AA W   +  GL+ M DVL +
Sbjct: 240 FAKGAVRAAKWLAQKEKGLFDMTDVLDL 267


>gi|254456352|ref|ZP_05069781.1| dihydrodipicolinate reductase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083354|gb|EDZ60780.1| dihydrodipicolinate reductase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 258

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 154/259 (59%), Gaps = 19/259 (7%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+ LIK   +N +  L S+   + +  I +    F GI P       N  +A +  D
Sbjct: 13  GRMGRQLIKSSKSNSNFKLVSL---TENIKINKK---FNGIKP-----EPNTEVAFKKSD 61

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            IIDF+ P  T++ L I+++     +IGTTGF+ KE+++I ++++  PI+K+ NMSLG+N
Sbjct: 62  IIIDFTIPKCTMEVLKIASKLKKRVVIGTTGFTQKEDKIIKNYSKKIPILKAGNMSLGVN 121

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK---VNLTDH 190
            L +L E A++ L    ++  +I E+HH+ K D PSGTAL+LG+ IA G+     NL   
Sbjct: 122 LLMYLTEIASKSL--GDNYLSKIFEIHHKHKKDYPSGTALMLGKGIAVGKNKDLYNLIGK 179

Query: 191 MVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLT 250
             LN+      +    I   S+R G I+GEH V  +   E ITL+H A+DRR+++ G+LT
Sbjct: 180 KFLNKKNIPYGK---KINFNSIRKGEIIGEHEVKFSSGKEIITLNHEAFDRRLYSDGALT 236

Query: 251 AALWAKSQIPGLYSMRDVL 269
           AA W   + PGLYSMRD+L
Sbjct: 237 AAKWLMKKKPGLYSMRDLL 255


>gi|103488224|ref|YP_617785.1| dihydrodipicolinate reductase [Sphingopyxis alaskensis RB2256]
 gi|98978301|gb|ABF54452.1| dihydrodipicolinate reductase [Sphingopyxis alaskensis RB2256]
          Length = 241

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 130/219 (59%), Gaps = 2/219 (0%)

Query: 53  GISPMGIKFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEV 112
           G    G+    N+A    S D ++DFSSPA    +L+         +IGTTG   + + +
Sbjct: 25  GQRSCGVDKGGNVARLAASADVLVDFSSPAALEATLDACVAAGKPIVIGTTGLEERHHYL 84

Query: 113 ISSFARNAPIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTA 172
           I   AR+  ++++ N SLG+  L  LV  AA  L P  ++D EI+EMHHR K+D+PSGTA
Sbjct: 85  IDDAARDVAVLQTGNTSLGVTLLAHLVREAAARLDP--EYDIEIVEMHHRNKVDAPSGTA 142

Query: 173 LLLGEAIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESI 232
           LLLGEA A GR ++L       R     AR  G IG ASLR G++ G+H V+ AG  E I
Sbjct: 143 LLLGEAAAEGRGISLATCSERGRDGLTGARGHGKIGFASLRGGTVAGDHDVIFAGPEEMI 202

Query: 233 TLSHSAYDRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           TLSH A +R IFARG++ AALW   Q PG Y+M  VLG+
Sbjct: 203 TLSHRAENRMIFARGAVKAALWLIHQKPGRYTMPQVLGL 241


>gi|169634899|ref|YP_001708635.1| dihydrodipicolinate reductase [Acinetobacter baumannii SDF]
 gi|238688152|sp|B0VPZ8|DAPB_ACIBS RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|169153691|emb|CAP02889.1| dihydrodipicolinate reductase [Acinetobacter baumannii]
          Length = 273

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 159/272 (58%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRTLIQAVQQ-AGYQLAAAVERPESSLVGTDAGELAGIGSVGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S +LA  ++  D IIDF++PA T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVSGSLADVLKDCDVIIDFTAPAATAQHLKLCREAGVAMVIGTTGMSDEQKAELDEAATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 IPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRDRQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|218767107|ref|YP_002341619.1| dihydrodipicolinate reductase [Neisseria meningitidis Z2491]
 gi|14547968|sp|Q9JX48|DAPB_NEIMA RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|121051115|emb|CAM07386.1| dihydrodipicolinate reductase [Neisseria meningitidis Z2491]
          Length = 269

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 156/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDTVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIRAAAEKTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L+  + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVA--LVLNEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|313201621|ref|YP_004040279.1| dihydrodipicolinate reductase [Methylovorus sp. MP688]
 gi|312440937|gb|ADQ85043.1| dihydrodipicolinate reductase [Methylovorus sp. MP688]
          Length = 274

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 153/258 (59%), Gaps = 3/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG AL++ +  + ++ LH+ + R  SP +G+D G   G     +  S ++A A+   D
Sbjct: 19  GRMGYALLEGVFADEALQLHAALDRPDSPQLGRDAGEQFG-RKTDVLISHDVAAALAGAD 77

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            ++DF+ P  +LQ L    +  +  +IGTTGF+ ++ ++I + + +  +V + NMS+G+ 
Sbjct: 78  VLVDFTRPEPSLQYLQACREAGVAMVIGTTGFTPEQKQLIEAASADIAVVFAPNMSVGVT 137

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L  LV+ AA+ L  ++ +D E++E HHR K+D+PSGTAL LGEA A     +L    V 
Sbjct: 138 LLINLVKEAAKVL--SEGYDIEVIEAHHRHKVDAPSGTALRLGEAAAEALGRDLASCAVY 195

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R   +IG A++R G +VG+H+V+ AG GE + L+H A  R  FA G+L AA 
Sbjct: 196 GREGVTGERDPSTIGFATVRGGDVVGDHTVLFAGIGERVELTHKASSRATFALGALRAAK 255

Query: 254 WAKSQIPGLYSMRDVLGI 271
           +   +  GL+ MRDVL +
Sbjct: 256 FLTGRSSGLFDMRDVLSL 273


>gi|56416968|ref|YP_154042.1| dihydrodipicolinate reductase [Anaplasma marginale str. St. Maries]
 gi|56388200|gb|AAV86787.1| dihydrodipicolinate reductase [Anaplasma marginale str. St. Maries]
          Length = 280

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 152/265 (57%), Gaps = 11/265 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G  GRMG+ +++E+     + L   +VR G+ L+G+D+G  +G    G K +D+
Sbjct: 24  MKIGIVGCLGRMGRIIVQEVVGTGGVELSGGVVRRGNGLVGEDMGAVLGCGH-GAKITDS 82

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                   D +IDFSSP   L+ + I+++  +  + GTTG   ++     + A   P++ 
Sbjct: 83  KEFLFDCSDVVIDFSSPECMLECVGIASEKRVPLVSGTTGVDERD---FRTHAEKVPLLW 139

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+  L  LV+ AA      + +D EI E+HHR K D+PSGT+L+LG+A+A G  
Sbjct: 140 SCNMSLGVTLLLELVKMAAAGF---RGYDVEIRELHHRAKKDAPSGTSLMLGKAVAQGMG 196

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L              R  G++G +  R G ++G+H+V+  G+ E + L H A DRR+F
Sbjct: 197 VELESQ---QHTFGSGCRRSGAVGFSVARGGGVIGDHAVMFLGDDEIVELQHRAIDRRVF 253

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           ARG++ AA W   +  GLY+M DVL
Sbjct: 254 ARGAIKAACWLVGKPAGLYTMSDVL 278


>gi|301170046|emb|CBW29650.1| dihydrodipicolinate reductase [Haemophilus influenzae 10810]
          Length = 270

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 147/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  S 
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSG 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKAAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEHSV  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHSVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|299768283|ref|YP_003730309.1| dihydrodipicolinate reductase [Acinetobacter sp. DR1]
 gi|298698371|gb|ADI88936.1| dihydrodipicolinate reductase [Acinetobacter sp. DR1]
          Length = 273

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 106/272 (38%), Positives = 158/272 (58%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  +P RI +LG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSAAP-RIGILGAGGRMGRTLIQAVQQ-AGYQLAAAVERPESSLVGTDAGELAGIGSVGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S +LA  ++  D IIDF++P  T Q L +  +  +  +IGTTG S ++   +   A +
Sbjct: 59  KVSGSLADVLKDCDVIIDFTAPVATAQHLKLCREAGVAMVIGTTGMSDEQKAELDEVATH 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E AA+        D E++E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVSIKLLELAAKVF--GDTVDIEVIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A+    NL +  V  R      R   +IG  ++R G IVGEH+V+  GEGE + ++H A 
Sbjct: 177 ADTLGRNLKEVAVYGREGHTGPRERQTIGFETIRGGDIVGEHTVMFIGEGERVEVTHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG+
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGL 268


>gi|325203322|gb|ADY98775.1| dihydrodipicolinate reductase [Neisseria meningitidis M01-240355]
          Length = 269

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDTVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIRAAAEKTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKAGSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|145633218|ref|ZP_01788949.1| dihydrodipicolinate reductase [Haemophilus influenzae 3655]
 gi|144986064|gb|EDJ92654.1| dihydrodipicolinate reductase [Haemophilus influenzae 3655]
          Length = 270

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 147/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS  +G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSSVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|237749493|ref|ZP_04579973.1| dihydrodipicolinate reductase [Oxalobacter formigenes OXCC13]
 gi|229380855|gb|EEO30946.1| dihydrodipicolinate reductase [Oxalobacter formigenes OXCC13]
          Length = 268

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 156/269 (57%), Gaps = 4/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S M+I++ G  GRMG  LI+ +       L   +    SP +G D G F+G    G+   
Sbjct: 2   SKMKIAIAGANGRMGHMLIEAVLKADDAVLTGALDVPDSPNLGNDAGMFLG-EKTGVTVE 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
            +++ A++  + +IDF+ P  TL+ L+   ++NI  IIGTTGF     + I+  A    +
Sbjct: 61  SDISRALEGAEYLIDFTRPEGTLKHLDYCVKNNIKIIIGTTGFDEAGKKTIAKAAETISV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V + NMS+G+N    L+E AA+    A+ +D E++E HHR K+D+PSGTAL +GE IAN 
Sbjct: 121 VFAPNMSVGVNVTMKLLEIAAKNF--AEGYDIEVIEAHHRHKVDAPSGTALKMGEVIANA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V +R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R 
Sbjct: 179 IGRDLKECGVFSREGITGERDPSTIGFSTIRGGDIVGDHTVLFAGTGERIEITHKSASRA 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +A+GSL A  +   +  GL+ M+DVLG+
Sbjct: 239 TYAQGSLRACRFLADKKNGLFDMQDVLGL 267


>gi|309973179|gb|ADO96380.1| Dihydrodipicolinate reductase [Haemophilus influenzae R2846]
          Length = 270

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 147/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG  LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGCQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  +L+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGSLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|329114980|ref|ZP_08243735.1| Dihydrodipicolinate reductase [Acetobacter pomorum DM001]
 gi|326695423|gb|EGE47109.1| Dihydrodipicolinate reductase [Acetobacter pomorum DM001]
          Length = 259

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 144/267 (53%), Gaps = 12/267 (4%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI + G  GR+G+ L++E+      TL     R      G          P G+    +
Sbjct: 1   MRIGIAGITGRVGRLLVEEVQAA-GATLSGGTTRKPEAASGL---------PQGVALFKD 50

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +A    + D +IDF+     + +    A      ++GTTG S ++   ++  A    +V 
Sbjct: 51  MAELAANSDVVIDFTHADTVIPNAQALAAAGTAWVLGTTGLSAEQQTAVNKAAEKIAVVH 110

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S G+  +  L +  A  L PA  +D EI+EMHHR+K+D+PSGTAL +GEA+A GR 
Sbjct: 111 AANYSPGVTLVQRLAQMMARAL-PADSYDAEIVEMHHRQKVDAPSGTALAIGEAVAQGRG 169

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           VNL D     R      R EG+IG A+LR G IVGEH V+     E I L H A+DRRIF
Sbjct: 170 VNLADVRESGRDGHTGPRKEGAIGFAALRGGQIVGEHEVLFTSADEQIVLGHRAFDRRIF 229

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W K   PGLYSM DVLG+
Sbjct: 230 ATGAVRAAKWVKGHKPGLYSMEDVLGL 256


>gi|261400959|ref|ZP_05987084.1| dihydrodipicolinate reductase [Neisseria lactamica ATCC 23970]
 gi|269209204|gb|EEZ75659.1| dihydrodipicolinate reductase [Neisseria lactamica ATCC 23970]
          Length = 269

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS ++G D G   GI   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEVLGLDAGFSSGIK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    +
Sbjct: 61  DDVDAVLAQSDVLIDFTRPDPTLKHLQKCVEKGVCIIIGTTGFDDAGKAAIRAAAEKTGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVAHVL--NEGYDIEIIEAHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSAIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|251792448|ref|YP_003007174.1| dihydrodipicolinate reductase [Aggregatibacter aphrophilus NJ8700]
 gi|247533841|gb|ACS97087.1| dihydrodipicolinate reductase [Aggregatibacter aphrophilus NJ8700]
          Length = 270

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            +RI+++G GGRMG+ LI+ +HN   + L +   R GS LIG D G   GI  +G+K  D
Sbjct: 2   ALRIAIVGAGGRMGRQLIQAVHNAEGVELGAAFERVGSSLIGADAGELAGIGSLGVKVGD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL  L   + ++   IIGTTGF       I + A    IV
Sbjct: 62  DLNAVKDQFDVLIDFTRPEGTLAHLAFCSANHKNMIIGTTGFDDAGKAAIKAAAEKIGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    I  +++RA  +VGEHSV  A  GE + ++H A  R  
Sbjct: 180 GRDLKTHGVFCRDGIIGERKRDEIAFSTIRASDVVGEHSVWFADIGERVEIAHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ AA W + +  GL+ M DVL
Sbjct: 240 FANGAVRAAKWLEGKDKGLFDMTDVL 265


>gi|148826044|ref|YP_001290797.1| dihydrodipicolinate reductase [Haemophilus influenzae PittEE]
 gi|166222637|sp|A5UCB3|DAPB_HAEIE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|148716204|gb|ABQ98414.1| dihydrodipicolinate reductase [Haemophilus influenzae PittEE]
          Length = 270

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 147/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  +L+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGSLEHIAFCVANNKKMVIGTTGFDQNGKAAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHMVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|269958618|ref|YP_003328405.1| dihydrodipicolinate reductase [Anaplasma centrale str. Israel]
 gi|90101227|sp|Q5PA93|DAPB_ANAMM RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|269848447|gb|ACZ49091.1| dihydrodipicolinate reductase [Anaplasma centrale str. Israel]
          Length = 257

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 152/265 (57%), Gaps = 11/265 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G  GRMG+ +++E+     + L   +VR G+ L+G+D+G  +G    G K +D+
Sbjct: 1   MKIGIVGCLGRMGRIIVQEVVGTGGVELSGGVVRRGNGLVGEDMGAVLGCGH-GAKITDS 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                   D +IDFSSP   L+ + I+++  +  + GTTG   ++     + A   P++ 
Sbjct: 60  KEFLFDCSDVVIDFSSPECMLECVGIASEKRVPLVSGTTGVDERD---FRTHAEKVPLLW 116

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+  L  LV+ AA      + +D EI E+HHR K D+PSGT+L+LG+A+A G  
Sbjct: 117 SCNMSLGVTLLLELVKMAAAGF---RGYDVEIRELHHRAKKDAPSGTSLMLGKAVAQGMG 173

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L              R  G++G +  R G ++G+H+V+  G+ E + L H A DRR+F
Sbjct: 174 VELESQ---QHTFGSGCRRSGAVGFSVARGGGVIGDHAVMFLGDDEIVELQHRAIDRRVF 230

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           ARG++ AA W   +  GLY+M DVL
Sbjct: 231 ARGAIKAACWLVGKPAGLYTMSDVL 255


>gi|240017483|ref|ZP_04724023.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae FA6140]
 gi|240113905|ref|ZP_04728395.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae MS11]
 gi|240116637|ref|ZP_04730699.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID18]
 gi|268599966|ref|ZP_06134133.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae MS11]
 gi|268602303|ref|ZP_06136470.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID18]
 gi|268584097|gb|EEZ48773.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae MS11]
 gi|268586434|gb|EEZ51110.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID18]
          Length = 269

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIRAAAEKTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKAGSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|241759177|ref|ZP_04757285.1| dihydrodipicolinate reductase [Neisseria flavescens SK114]
 gi|241320596|gb|EER56873.1| dihydrodipicolinate reductase [Neisseria flavescens SK114]
          Length = 269

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 156/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S ++I++ G  GRMG+ L++ ++N+P   L   +  SGS ++G D G   G+   G+  S
Sbjct: 2   SALKIAIAGVNGRMGRVLVEAVNNHPDAVLSGALEHSGSEVLGLDAGFASGLK-TGVAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      +
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKGVNIIIGTTGFDDAGKAAIQAAGEKIGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA+ 
Sbjct: 121 VFAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIADA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L +  V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKECAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+WA  +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWANGK-KGLYDMQDVLGL 266


>gi|254995145|ref|ZP_05277335.1| dihydrodipicolinate reductase [Anaplasma marginale str.
           Mississippi]
 gi|255004441|ref|ZP_05279242.1| dihydrodipicolinate reductase [Anaplasma marginale str. Virginia]
          Length = 271

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 152/265 (57%), Gaps = 11/265 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G  GRMG+ +++E+     + L   +VR G+ L+G+D+G  +G    G K +D+
Sbjct: 15  MKIGIVGCLGRMGRIIVQEVVGTGGVELSGGVVRRGNGLVGEDMGAVLGCGH-GAKITDS 73

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                   D +IDFSSP   L+ + I+++  +  + GTTG   ++     + A   P++ 
Sbjct: 74  KEFLFDCSDVVIDFSSPECMLECVGIASEKRVPLVSGTTGVDERD---FRTHAEKVPLLW 130

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+  L  LV+ AA      + +D EI E+HHR K D+PSGT+L+LG+A+A G  
Sbjct: 131 SCNMSLGVTLLLELVKMAAAGF---RGYDVEIRELHHRAKKDAPSGTSLMLGKAVAQGMG 187

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L              R  G++G +  R G ++G+H+V+  G+ E + L H A DRR+F
Sbjct: 188 VELESQ---QHTFGSGCRRSGAVGFSVARGGGVIGDHAVMFLGDDEIVELQHRAIDRRVF 244

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           ARG++ AA W   +  GLY+M DVL
Sbjct: 245 ARGAIKAACWLVGKPAGLYTMSDVL 269


>gi|237747344|ref|ZP_04577824.1| dihydrodipicolinate reductase [Oxalobacter formigenes HOxBLS]
 gi|229378695|gb|EEO28786.1| dihydrodipicolinate reductase [Oxalobacter formigenes HOxBLS]
          Length = 268

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 153/265 (57%), Gaps = 4/265 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I++ G  GRMG  LI+ +       L   +  S SP +G D G F+G    G+    +
Sbjct: 4   MKIAIAGANGRMGHMLIEAVLKAEDAILTGALDASNSPGLGNDAGMFLG-EKTGVPIVSD 62

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +  A +  + +IDF+ PA TL+ L   A H I  IIGTTGF     + I++ + + P+V 
Sbjct: 63  MNKAFRDAEYVIDFTRPAGTLEHLAYCAAHQIKMIIGTTGFDENGKKAIAAASTSIPVVF 122

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L+E AA+    A+ +D E++E HHR K+D+PSGTAL +GE IA    
Sbjct: 123 APNMSVGVNVTMKLLEIAAKNF--AEGYDIEVIEAHHRHKVDAPSGTALKMGEVIAKAIG 180

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  +  R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +
Sbjct: 181 RDLGECAIYAREGITGERDPSTIGFSTIRGGDIVGDHTVLFAGTGERIEITHKSASRATY 240

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A+GSL AA +   +  GL+ M+DVL
Sbjct: 241 AQGSLRAARFLTDKTSGLFDMQDVL 265


>gi|296313309|ref|ZP_06863250.1| dihydrodipicolinate reductase [Neisseria polysaccharea ATCC 43768]
 gi|296840188|gb|EFH24126.1| dihydrodipicolinate reductase [Neisseria polysaccharea ATCC 43768]
          Length = 269

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  S
Sbjct: 2   TPLKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    I
Sbjct: 61  DDVDTVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIRAAAEKTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA  
Sbjct: 121 VFAANFSVGVNLTFHILDTIARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|332529579|ref|ZP_08405535.1| dihydrodipicolinate reductase [Hylemonella gracilis ATCC 19624]
 gi|332040929|gb|EGI77299.1| dihydrodipicolinate reductase [Hylemonella gracilis ATCC 19624]
          Length = 280

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 155/266 (58%), Gaps = 4/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           R++V G  GRMG+ LI+ +  + S  L   + +  S  +GQ+   F+G +  G+  + +L
Sbjct: 17  RVAVAGASGRMGRMLIEAVQASTSHQLAGALDQPQSAALGQEATAFLGQTS-GVAITSDL 75

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
              +Q    +IDF+ P  T+  L +  +  +  +IGTTGFS  +   IS+ AR+ PIV +
Sbjct: 76  RAGLQDAGTLIDFTRPEGTMAHLAVCRELGVALVIGTTGFSDAQKAEISAAARDIPIVLA 135

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N    L+  AA+ L  +  +D EI+E HHR K+D+PSGTAL +GE IA     
Sbjct: 136 PNMSVGVNVTLKLLAMAAQAL--STGYDIEIIEAHHRHKVDAPSGTALKMGEVIAEALGR 193

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L D  V  R+     R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  +A
Sbjct: 194 DLKDCAVYERYGHTGERDPSTIGFSTIRGGDIVGDHTVLFAGTGERIEITHKSASRATYA 253

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +GSL A  +   +  GLY M DVLG+
Sbjct: 254 QGSLRAVSFLADKQNGLYDMFDVLGL 279


>gi|261364787|ref|ZP_05977670.1| dihydrodipicolinate reductase [Neisseria mucosa ATCC 25996]
 gi|288566809|gb|EFC88369.1| dihydrodipicolinate reductase [Neisseria mucosa ATCC 25996]
          Length = 269

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 154/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S ++I++ G  GRMG+ L++ ++N+P   L   +  SGS ++G D G   GI   GI  S
Sbjct: 2   SALKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEVLGLDAGFASGIK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      +
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKGVNIIIGTTGFDDAGKAAIQAAGEKTGV 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA+ 
Sbjct: 121 VFAANFSVGVNLTFHILDTIARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIADA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATIRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAVWVNGK-TGLYDMQDVLGL 266


>gi|319791128|ref|YP_004152768.1| dihydrodipicolinate reductase [Variovorax paradoxus EPS]
 gi|315593591|gb|ADU34657.1| dihydrodipicolinate reductase [Variovorax paradoxus EPS]
          Length = 280

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 153/268 (57%), Gaps = 4/268 (1%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P RI++ G  GRMG  LI+ + N P   L   +  +GS  IG D   F+G +  G+    
Sbjct: 15  PRRIAIAGASGRMGHMLIEAVRNAPDCRLAGALDIAGSEAIGNDAAAFLGFTS-GVPIVA 73

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L   ++    +IDF+ P  TL  L +  +  +  +IGTTGFS  +   I+  A++  I+
Sbjct: 74  DLRTGLKDAQVLIDFTRPEGTLAHLAVCRELGVQAVIGTTGFSDAQKAEIAEIAKDVAIM 133

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            + NMS+G+N    L+E AA+ +  +  +D EI+E HHR K+D+PSGTAL +GE IA+  
Sbjct: 134 LAPNMSVGVNVTFKLLEMAAKAM--STGYDIEIIEAHHRHKVDAPSGTALKMGEVIADAL 191

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L D  V  R      R   +IG +++R G IVG+H+V+ AG GE I ++H +  R  
Sbjct: 192 GRDLKDCAVYAREGITGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSSSRVT 251

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +A+G+L A  +   Q  GL+ M DVLG+
Sbjct: 252 YAQGALRAVRFLAEQKSGLFDMYDVLGL 279


>gi|94500155|ref|ZP_01306689.1| dihydrodipicolinate reductase [Oceanobacter sp. RED65]
 gi|94427728|gb|EAT12704.1| dihydrodipicolinate reductase [Oceanobacter sp. RED65]
          Length = 268

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 150/267 (56%), Gaps = 4/267 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGI-SPMGIKFSDN 64
           RI+++G  GRMG+ LI+      +  L + +V     L G D G   G+   + +  + +
Sbjct: 4   RIAIIGAAGRMGRILIEATDAADNAVLGAGVVLPDDSLKGADAGEMAGLGKKLNVALAGS 63

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF+SP  T+Q++    QH    +IGTTG +  +   + +  +  PIV 
Sbjct: 64  LEDVVNDFDVLIDFTSPETTMQNIEFCKQHGKGIVIGTTGLNDDQKASLQASGKELPIVF 123

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + N S+G+N    L+  AA  +    D D EI+EMHHR K+D+PSGTAL +GE IA+   
Sbjct: 124 APNYSVGVNLCLNLLRMAASIM--GNDSDIEIIEMHHRHKVDAPSGTALRMGEVIADTLD 181

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R  Q  AR +  IG  ++R G +VG+H+V+ A +GE + ++H A  R  F
Sbjct: 182 WDLKEVAVYGREGQTGARPQKQIGFETIRGGDVVGDHTVMFAADGERVEVTHKAQSRMTF 241

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A+G++ AA W K +  G+Y M DVLG 
Sbjct: 242 AKGAVRAAAWLKGKDNGVYDMPDVLGF 268


>gi|58698429|ref|ZP_00373339.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58535052|gb|EAL59141.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Drosophila
           ananassae]
          Length = 248

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 148/257 (57%), Gaps = 12/257 (4%)

Query: 16  MGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVDGI 75
           MG+ ++ E+  N  + +   + RSGS  I  D+G    I+ +GIK + +++   +S D +
Sbjct: 1   MGKKILNELITNTKVEIAGAVARSGSKYIDSDIGPI--IANLGIKVTSSISDVFESSDVV 58

Query: 76  IDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGINFL 135
           IDF++    L  L  + +     + GTTG    E   +  +A   PI+ S+NMS+G+N L
Sbjct: 59  IDFTTKECMLDCLKAAVKFKTPLVSGTTGI---EGVDLKEYAAEVPILWSANMSVGVNVL 115

Query: 136 GFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVLNR 195
             LV+ AAE L    ++D EI EMHH  K DSPSGTA+ LG+ IAN  KV+   +  L  
Sbjct: 116 LKLVKKAAELL--GNEYDVEIWEMHHNLKKDSPSGTAIELGKTIANASKVDFQSNQYL-- 171

Query: 196 HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAALWA 255
           H     R +G IG A  R G ++G+HSV+     E I L+H A DR  FARG++ AA+W 
Sbjct: 172 HSGSNIRKKGGIGFAVSRGGGVIGDHSVMFVNSDERIELNHKAIDRTTFARGAVQAAVWL 231

Query: 256 ---KSQIPGLYSMRDVL 269
              K +IPGLYSM+DV+
Sbjct: 232 YENKREIPGLYSMQDVI 248


>gi|190570574|ref|YP_001974932.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019178|ref|ZP_03334985.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|238057934|sp|B3CN84|DAPB_WOLPP RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|190356846|emb|CAQ54216.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995287|gb|EEB55928.1| dihydrodipicolinate reductase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 262

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 159/269 (59%), Gaps = 14/269 (5%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISP-MGIKFSD 63
           +R+ V+G  GRMG+ ++ E+  N  + +   + R GS  IG D+G  VG +  +GIK + 
Sbjct: 3   IRVGVIGCLGRMGKKILNELITNTKVEIAGAVARLGSEYIGLDIGPIVGNNCNLGIKITS 62

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +++   +S D +IDF++    L+ L  + +     + GTTG    E   +  +A   PI+
Sbjct: 63  SISEVFESSDVVIDFTTKECMLECLKAAVKFKKPLVSGTTGI---EGLNLKDYAAKVPIL 119

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            S+NMS+G+N L  LV+ AA+ L    ++D EI EMHH  K DSPSGTA+  G+A+AN  
Sbjct: 120 WSANMSIGVNVLLKLVKEAAKLL--GNEYDVEIWEMHHNLKKDSPSGTAIEFGKAVANAA 177

Query: 184 KVNLTDHMVLNR--HIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           KV+      LN+  H     R +G IG A  R G ++G+HSV+     E + L+H A DR
Sbjct: 178 KVDFE----LNQYSHNNSNIRGKGGIGFAVSRGGGVIGDHSVMFVNYDERVELNHKAIDR 233

Query: 242 RIFARGSLTAALW-AKSQIPGLYSMRDVL 269
             FARG++ AA+W  +++ PGLYSM+D++
Sbjct: 234 TTFARGAVQAAIWLCENKTPGLYSMQDLV 262


>gi|301057680|ref|ZP_07198755.1| dihydrodipicolinate reductase [delta proteobacterium NaphS2]
 gi|300448226|gb|EFK11916.1| dihydrodipicolinate reductase [delta proteobacterium NaphS2]
          Length = 267

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 150/267 (56%), Gaps = 3/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+V G  GRMG  +I  IH NP   L           +G D G+  G+  +G++   N
Sbjct: 2   VKIAVAGAAGRMGGRIIHMIHQNPQTDLVGAFEYPDHASVGDDAGSVAGVGDLGVRIYGN 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +  A+     +IDF++P  TL +   +++  I  +IGTTG      + I S +   P V 
Sbjct: 62  MNEAVTGAHVLIDFTAPESTLLNAKGASEKGIPMVIGTTGIDDDGVKKIKSVSEKIPCVM 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N +  +    A  L   K++D EILE+HHR K D+PSGTA+ LG+ +A+   
Sbjct: 122 APNMSVGVNVMFKIAGEMARIL--GKEYDMEILEVHHRLKKDAPSGTAMRLGQILADAVD 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L +  V  R      RT+  IGI + RAG I GEH+V+  G GE + L+H A++R  F
Sbjct: 180 RDLENVGVYGRKGMIGERTDEEIGIQTWRAGDIAGEHTVMFGGIGERLELTHRAHNRDNF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           ARG++ AALW   +  G Y M+DVLG+
Sbjct: 240 ARGAVRAALWIAGKPAGFYDMQDVLGL 266


>gi|59802100|ref|YP_208812.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae FA 1090]
 gi|194099979|ref|YP_002003118.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae NCCP11945]
 gi|239997987|ref|ZP_04717911.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae 35/02]
 gi|240124731|ref|ZP_04737617.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae SK-92-679]
 gi|254494658|ref|ZP_05107829.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae 1291]
 gi|260439602|ref|ZP_05793418.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae DGI2]
 gi|268593839|ref|ZP_06128006.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae 35/02]
 gi|268683310|ref|ZP_06150172.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae SK-92-679]
 gi|291042843|ref|ZP_06568584.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae DGI2]
 gi|293398138|ref|ZP_06642343.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae F62]
 gi|75432371|sp|Q5F5Y7|DAPB_NEIG1 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|238693232|sp|B4RR35|DAPB_NEIG2 RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|59718995|gb|AAW90400.1| putative dihydrodipicolinate reductase [Neisseria gonorrhoeae FA
           1090]
 gi|193935269|gb|ACF31093.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae NCCP11945]
 gi|226513698|gb|EEH63043.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae 1291]
 gi|268547228|gb|EEZ42646.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae 35/02]
 gi|268623594|gb|EEZ55994.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae SK-92-679]
 gi|291013277|gb|EFE05243.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae DGI2]
 gi|291611401|gb|EFF40471.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae F62]
 gi|317165430|gb|ADV08971.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 269

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 154/268 (57%), Gaps = 5/268 (1%)

Query: 5   PMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
           P++I++ G  GRMG+ L++ ++N+P   L   +  SGS  +G D G  VG+   GI  SD
Sbjct: 3   PLKIAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAVGLK-TGIAISD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           ++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I + A    IV
Sbjct: 62  DVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDAGKAAIRAAAEKTGIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            ++N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FAANFSVGVNLTFHILDTVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGAL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R  
Sbjct: 180 GRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKAGSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVLGI 271
           FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 240 FAAGAVRAAVWVNGKT-GLYDMQDVLGL 266


>gi|307293104|ref|ZP_07572950.1| dihydrodipicolinate reductase [Sphingobium chlorophenolicum L-1]
 gi|306881170|gb|EFN12386.1| dihydrodipicolinate reductase [Sphingobium chlorophenolicum L-1]
          Length = 254

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/260 (42%), Positives = 145/260 (55%), Gaps = 18/260 (6%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIG-QDVGNFVGISPMGIKFS-DNLAMAIQS 71
           GRMG+A+ +            I+  +G  + G  D G    I+P GI  + D  A+A QS
Sbjct: 11  GRMGRAIAQ------------IVQEAGLKIAGGTDRGGEGEIAP-GISITTDPHALARQS 57

Query: 72  VDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLG 131
            D +IDFS P      L+         +IGTTG     + +I   A+  P++++ N SLG
Sbjct: 58  -DVLIDFSVPGALSAHLDACIATKKPVLIGTTGLEPAHHALIDEAAKRIPLLQTGNTSLG 116

Query: 132 INFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHM 191
           +N L  LVE AA  L    DWD EI+EMHHR K+D+PSGTALLLGEA A GR + L DH 
Sbjct: 117 VNLLAALVEQAASRL--GDDWDIEIVEMHHRHKVDAPSGTALLLGEAAAQGRGIALADHS 174

Query: 192 VLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTA 251
              R     AR  G+IG A+LR GS+ G+H V+ A EGE I + H A  R IFARG++  
Sbjct: 175 ERGRDGITGARARGAIGFAALRGGSVAGDHQVIFAAEGERIEIGHRAESRIIFARGAVKG 234

Query: 252 ALWAKSQIPGLYSMRDVLGI 271
           A W   Q  G Y M+ VLG+
Sbjct: 235 ARWLIGQPIGRYDMKGVLGL 254


>gi|145634916|ref|ZP_01790623.1| dihydrodipicolinate reductase [Haemophilus influenzae PittAA]
 gi|229845122|ref|ZP_04465257.1| dihydrodipicolinate reductase [Haemophilus influenzae 6P18H1]
 gi|145267782|gb|EDK07779.1| dihydrodipicolinate reductase [Haemophilus influenzae PittAA]
 gi|229811958|gb|EEP47652.1| dihydrodipicolinate reductase [Haemophilus influenzae 6P18H1]
          Length = 270

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 148/266 (55%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG+ LI+ +H+   + L +   R GS L+G D G   GI  +G+   D
Sbjct: 2   TLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGQIGVIVLD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  TL+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGTLEHIVFCVANNKKMVIGTTGFDENGKAAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E+HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEVHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH+V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|311104365|ref|YP_003977218.1| dihydrodipicolinate reductase [Achromobacter xylosoxidans A8]
 gi|310759054|gb|ADP14503.1| dihydrodipicolinate reductase [Achromobacter xylosoxidans A8]
          Length = 263

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 150/267 (56%), Gaps = 5/267 (1%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI++ G  GRMGQ LI+ + N   + L   + R GS  +GQD G  +G    G+  +D+
Sbjct: 1   MRIAIAGASGRMGQMLIEAVLNASGLQLAVALDRQGSAALGQDAGAPLG-KQTGVAITDD 59

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF+ P  TL+ L    +H +  +IGTTGF       I   A+   IV 
Sbjct: 60  LD-ALAQADCLIDFTRPEGTLEHLQACVKHGVNAVIGTTGFDDNGRAEIEVAAQKIGIVF 118

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N    L++ AA  L     +D E+ E HHR K+D+PSGTAL +GE IA+   
Sbjct: 119 APNMSVGVNATLKLLDMAARIL--NSGYDVEVFEAHHRNKVDAPSGTALKMGETIASAWN 176

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D    +RH     R  G+IG + LR G IVG+H+V   G GE I ++H +  R  +
Sbjct: 177 VALPDVATWSRHGDTGVRKPGTIGFSVLRGGDIVGDHTVSFCGIGERIEITHRSASRATY 236

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G+L AA + + +  GLY M+ VLG 
Sbjct: 237 AEGALRAARFLEGKHNGLYDMQSVLGF 263


>gi|294338477|emb|CAZ86803.1| Dihydrodipicolinate reductase (DHPR) [Thiomonas sp. 3As]
          Length = 282

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 152/266 (57%), Gaps = 4/266 (1%)

Query: 7   RISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           RI++ G  GRMG+ L++ +   P  ++ + +   GSP +GQD G F G+   G+    +L
Sbjct: 19  RIAIAGASGRMGRTLVEAVLAAPDCSIGAALDMPGSPALGQDAGAFAGVHT-GVAIRSDL 77

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
             A+Q V   IDF+ P  T+  L       +  +IGTTGF   +   I   ++   IV +
Sbjct: 78  YAALQHVRYFIDFTRPEGTMAHLAACEAAGVAMVIGTTGFDEAQLARIRIASQRIAIVMA 137

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
            NMS+G+N +  L+E AA  L  A+ +D EI+E HHR K+D+PSGTAL +GE +A     
Sbjct: 138 PNMSIGVNVVFKLLEQAARAL--AQGYDIEIIEAHHRHKVDAPSGTALKMGEVVAGALGR 195

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R      R   +IG A++R G IVG+H+V+ AG GE I ++H +  R  +A
Sbjct: 196 DLKQCAVYGREGVTGERDPSTIGFATVRGGDIVGDHTVLFAGTGERIEITHKSSSRATYA 255

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
           +GSL A  +  ++  GL+ M+DVLG+
Sbjct: 256 QGSLRAVRFLAAKSHGLFDMQDVLGL 281


>gi|218672591|ref|ZP_03522260.1| putative dihydrodipicolinate reductase [Rhizobium etli GR56]
          Length = 256

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 110/270 (40%), Positives = 150/270 (55%), Gaps = 19/270 (7%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P++++V G  GRMG+ ++  +  +P       I R  +                G +  
Sbjct: 3   TPIKVAVAGANGRMGRTILPLLAADPDFAFVGGIGRDAA---------------AGAELI 47

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNIS-AQHNIVHIIGTTGFSVKENEVISSFARNAP 121
           D  A AI + D I+DF++ A   +   +  +      +IG TGF   E E I+  AR  P
Sbjct: 48  DRSA-AIAAADVILDFTTGAAAAELAGLCASAGGPALVIGATGFEPDELERIAEAARTIP 106

Query: 122 IVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIAN 181
           I++S N S+G+N L  LV  AA  L PA+ WD EILE HH +K+D+PSGTAL+LGEA A 
Sbjct: 107 ILRSGNFSIGVNMLVSLVTQAARAL-PAQGWDIEILEAHHNQKIDAPSGTALMLGEAAAE 165

Query: 182 GRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDR 241
           GR V+L       R      R    IG A LRAG +VGEH V+ A   E +TLSHSA DR
Sbjct: 166 GRGVSLASVERRGRDGMTGERPPDEIGFAVLRAGGLVGEHKVLFAAAEEVLTLSHSALDR 225

Query: 242 RIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            +FARG+L AA W   + PG Y+MR+VLG+
Sbjct: 226 GMFARGALAAARWITGRAPGEYNMRNVLGL 255


>gi|50086567|ref|YP_048077.1| dihydrodipicolinate reductase [Acinetobacter sp. ADP1]
 gi|81612962|sp|Q6F6R2|DAPB_ACIAD RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|49532541|emb|CAG70255.1| dihydrodipicolinate reductase [Acinetobacter sp. ADP1]
          Length = 273

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 106/272 (38%), Positives = 155/272 (56%), Gaps = 5/272 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  SP RI VLG GGRMG+ LI+ +       L + + R  S L+G D G   GI  +G+
Sbjct: 1   MSASP-RIGVLGAGGRMGRILIQAV-QQAGYQLAAAVERPESSLVGSDAGELAGIGHIGV 58

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARN 119
           K S +L   ++  D +IDF++P  T Q L +     +  +IGTTGFS ++ ++++  A  
Sbjct: 59  KISGSLVEVLKDCDVVIDFTAPVATEQHLKLCGDAGVAMVIGTTGFSEQQKQLLNETAHQ 118

Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAI 179
            P+V ++N S+G+N    L+E A++        D EI+E HHR K+D+PSGTAL++GEAI
Sbjct: 119 TPVVYAANYSVGVNVTIKLLELASKVF--GDSVDIEIIEAHHRHKVDAPSGTALMMGEAI 176

Query: 180 ANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAY 239
           A     +L    V  R      R   SIG  ++R G IVGEH+ +  GEGE + ++H A 
Sbjct: 177 AETLGRDLKQDAVYCREGHTGPRERQSIGFQTIRGGDIVGEHTAMFIGEGERVEITHKAT 236

Query: 240 DRRIFARGSLTAALWAKSQIPGLYSMRDVLGI 271
           +R  FA G++ AA W   +    Y M+DVLG 
Sbjct: 237 NRMNFAAGAVRAAAWVVGREARKYDMKDVLGF 268


>gi|258541391|ref|YP_003186824.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632469|dbj|BAH98444.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635526|dbj|BAI01495.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638581|dbj|BAI04543.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641635|dbj|BAI07590.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644690|dbj|BAI10638.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647745|dbj|BAI13686.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650798|dbj|BAI16732.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653789|dbj|BAI19716.1| dihydrodipicolinate reductase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 259

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 144/267 (53%), Gaps = 12/267 (4%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           MRI + G  GR+G+ L++E+      TL     R      G          P G+    +
Sbjct: 1   MRIGIAGITGRVGRLLVEEVQAA-GATLSGGTTRKPEAASGL---------PQGVPLFKD 50

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           +A    + D +IDF+     + +    A      ++GTTG S ++   ++  A    +V 
Sbjct: 51  MAELAANSDVVIDFTHADTVIPNAQALAAAGAAWVLGTTGLSAEQQSAVNKAAEKIAVVH 110

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           ++N S G+  +  L +  A  +LPA  +D EI+EMHHR+K+D+PSGTAL +GEA+A GR 
Sbjct: 111 AANYSPGVTLVQRLAQMMAR-VLPADSYDAEIVEMHHRQKVDAPSGTALAIGEAVAQGRG 169

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L D     R      R EG+IG A+LR G IVGEH V+     E I L H A+DRRIF
Sbjct: 170 VKLADVRESGRDGHTGPRKEGAIGFAALRGGQIVGEHEVLFTSADEQIVLGHRAFDRRIF 229

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W K   PGLYSM DVLG+
Sbjct: 230 ATGAVRAAKWVKGHKPGLYSMEDVLGL 256


>gi|229847457|ref|ZP_04467554.1| dihydrodipicolinate reductase [Haemophilus influenzae 7P49H1]
 gi|229809598|gb|EEP45325.1| dihydrodipicolinate reductase [Haemophilus influenzae 7P49H1]
          Length = 270

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 146/266 (54%), Gaps = 3/266 (1%)

Query: 5   PMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSD 63
            ++I++ G GGRMG  LI+ +H+   + L +   R GS L+G D G   GI  +G+  SD
Sbjct: 2   TLKIAIAGAGGRMGCQLIQAVHSAEGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSD 61

Query: 64  NLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIV 123
           +L       D +IDF+ P  +L+ +     +N   +IGTTGF       I + +    IV
Sbjct: 62  DLESQKDKFDLLIDFTRPEGSLEHIAFCVANNKKMVIGTTGFDENGKTAIKAASDKIAIV 121

Query: 124 KSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGR 183
            +SN S+G+N +  L+E AA+ +      D E++E HHR K+D+PSGTAL +GE IA   
Sbjct: 122 FASNFSVGVNLVFKLLEKAAKVM--GDYCDIEVIEAHHRHKVDAPSGTALSMGEHIAKTL 179

Query: 184 KVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRI 243
             +L  H V  R      R    IG +++RA  +VGEH V  A  GE + +SH A  R  
Sbjct: 180 GRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHMVWFADIGERVEISHKASSRMT 239

Query: 244 FARGSLTAALWAKSQIPGLYSMRDVL 269
           FA G++ A  W +++  GL+ M DVL
Sbjct: 240 FANGAVRAGKWLENKANGLFDMTDVL 265


>gi|294011939|ref|YP_003545399.1| dihydrodipicolinate reductase [Sphingobium japonicum UT26S]
 gi|292675269|dbj|BAI96787.1| dihydrodipicolinate reductase [Sphingobium japonicum UT26S]
          Length = 254

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 142/258 (55%), Gaps = 14/258 (5%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+A I +I     + +     R G   I   V       P+    +D LA+A Q  D
Sbjct: 11  GRMGRA-IAQIVQEAGLKIAGGTDRDGEGEIAPGV-------PI---TADPLALA-QRSD 58

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDFS PA     L+         +IGTTG     + +I   A+  P++++ N SLG+N
Sbjct: 59  VLIDFSVPAALSAHLDACIAAKKPVLIGTTGLEPAHHALIDEAAKRIPLLQTGNTSLGVN 118

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            +  LVE AA  L    DWD EI+EMHHR K+D+PSGTALLLGEA A GR + L DH   
Sbjct: 119 LMAALVEQAATRL--GDDWDIEIVEMHHRHKVDAPSGTALLLGEAAARGRGIALADHSER 176

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R     AR  G+IG A+LR GS+ G+H V+ A +GE I + H A  R IFARG++  A 
Sbjct: 177 GRDGITGARARGAIGFAALRGGSVAGDHQVIFAADGERIEIGHRAESRIIFARGAVKGAQ 236

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   Q  G Y M+ VLG+
Sbjct: 237 WLIGQPVGRYDMKGVLGL 254


>gi|34497250|ref|NP_901465.1| dihydrodipicolinate reductase [Chromobacterium violaceum ATCC
           12472]
 gi|39930971|sp|Q7NX34|DAPB_CHRVO RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|34103106|gb|AAQ59469.1| dihydrodipicolinate reductase [Chromobacterium violaceum ATCC
           12472]
          Length = 267

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 146/258 (56%), Gaps = 3/258 (1%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+ LI+ + + P   LH+ I R+ S  +GQD G F G S  G+  S +   A+   D
Sbjct: 12  GRMGRVLIEAVLDAPGARLHAAIDRADSGFVGQDAGLFCGRSS-GVFISSDFIAALDGAD 70

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDF+ P  TL+ +    +  +  +IGTTGF  +    I + A    IV +SN S+G+N
Sbjct: 71  VVIDFTRPEGTLEHMLACVERGVRMVIGTTGFDDEGKAAIRAAAGKIGIVFASNFSVGVN 130

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
               L++ AA  L   + +D EI+E HHR K+D+PSGTAL +GE IA+    +L    V 
Sbjct: 131 LTFKLLDMAARVL--NEGYDVEIIEAHHRFKVDAPSGTALRMGEVIADALGRDLKQCAVY 188

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      R   +IG A++R G +VG+H+ + A  GE + +SH A  R  FA G++ AA 
Sbjct: 189 GREGVTGERDPQAIGFATVRGGDVVGDHTALFAALGERVEISHKASSRATFANGAVRAAR 248

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   +  GL+ M+DVLG+
Sbjct: 249 WLSDKRNGLFDMQDVLGL 266


>gi|108802951|ref|YP_642888.1| dihydrodipicolinate reductase [Rubrobacter xylanophilus DSM 9941]
 gi|123069343|sp|Q1AZV2|DAPB_RUBXD RecName: Full=Dihydrodipicolinate reductase; Short=DHPR
 gi|108764194|gb|ABG03076.1| dihydrodipicolinate reductase [Rubrobacter xylanophilus DSM 9941]
          Length = 260

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 153/265 (57%), Gaps = 11/265 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           +R++V G  GRMG+ + +    +P + L   +V  GSP +G D+G   G    G+  S+ 
Sbjct: 2   IRVTVAGAAGRMGREVCRAALEDPEVVLAGGVVEPGSPEVGADLGELCGAGRAGVAASEE 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                     +++F++P  T++ L+    + +  +IGTTG S ++   +   AR  PIV 
Sbjct: 62  ---PPPEAGVLVEFTTPEATVEHLS----YGLPAVIGTTGLSEEQRAKVEEAARGVPIVL 114

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS+G+N L  +V   +E L P   +D EI+E HHR K D+PSGTALL+G A A+GR 
Sbjct: 115 APNMSVGVNLLLGVVRRLSEALGPG--YDIEIVEAHHRGKRDAPSGTALLMGRAAASGRG 172

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
             L +  V  R      R EG IGI +LR G++VGEH V+  G GE + + H A  RR F
Sbjct: 173 RRLEEVAVYGRE-GVSPRGEGEIGIHALRGGAVVGEHRVIFYGLGEEVEVVHRALSRRTF 231

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           A G+L AA +A +  PGLYSM+DVL
Sbjct: 232 AEGALRAARFAAAAQPGLYSMQDVL 256


>gi|255003316|ref|ZP_05278280.1| dihydrodipicolinate reductase [Anaplasma marginale str. Puerto
           Rico]
          Length = 271

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 152/265 (57%), Gaps = 11/265 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G  GRMG+ +++E+     + L   +VR G+ L+G+D+G  +G    G K +D+
Sbjct: 15  MKIGIVGCLGRMGRIIVQEVVGTGGVELSGGVVRRGNGLVGEDMGAVLGCGH-GAKITDS 73

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                   D +IDFSSP   L+ + I+++  +  + GTTG   ++     + A   P++ 
Sbjct: 74  KEFLFDCSDVVIDFSSPECMLECVGIASEKRVPLVSGTTGVDERD---FRTHAEKVPLLW 130

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+  L  LV+ AA      + +D EI E+HHR K D+PSGT+L+LG+A+A G  
Sbjct: 131 SCNMSLGVTLLLELVKMAAAGF---RGYDVEIRELHHRAKKDAPSGTSLMLGKAVAQGMG 187

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L              R  G++G +  R G ++G+H+V+  G+ E + L H A DRR+F
Sbjct: 188 VELESQ---QHTFGFGCRRSGAVGFSVARGGGVIGDHAVMFLGDDEIVELQHRAIDRRVF 244

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           ARG++ AA W   +  GLY+M DVL
Sbjct: 245 ARGAIKAACWLVGKPAGLYTMLDVL 269


>gi|83945060|ref|ZP_00957426.1| Dihydrodipicolinate reductase [Oceanicaulis alexandrii HTCC2633]
 gi|83851842|gb|EAP89697.1| Dihydrodipicolinate reductase [Oceanicaulis alexandrii HTCC2633]
          Length = 272

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 152/273 (55%), Gaps = 5/273 (1%)

Query: 1   MHQSPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGI 59
           M  S + I+V G  GR+G+A+  E+     ++L   +V S S  +G D+G       +GI
Sbjct: 1   MSGSSIHIAVTGISGRLGRAIATEVIRASDLSLVGGMVSSDSANLGADLGELCSAGFLGI 60

Query: 60  KFSDNLAMAIQSVDGIIDFSSPALTLQ-SLNISAQHNIVHIIGTTGFSVKENEVISSFAR 118
           +   +L       D +ID S P +T   +  ++A  N   + G TG    +   +   A 
Sbjct: 61  ETVVSLEQTADQADVLIDASLPKVTSAIAPRLAAMGNRALVTGVTGLDKDQQAALEHAAE 120

Query: 119 NAPIVKSSNMSLGINFLGFLVETAAEYLLPAKD-WDFEILEMHHRRKLDSPSGTALLLGE 177
             P++++SN SLG+  +  LV  AA  L  A D +D EI+E HH+RK DSPSGTAL LGE
Sbjct: 121 TIPVLQASNFSLGVALVERLVSQAARAL--ADDHFDLEIVEAHHKRKADSPSGTALSLGE 178

Query: 178 AIANGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHS 237
           A A  R V L D    +R  Q   R  G+IG +++R G +VGEH        E +++SH 
Sbjct: 179 AAARARGVELEDVAQFSRPRQDGHRPVGAIGFSAIRGGGVVGEHEARFLSAFEEVSISHK 238

Query: 238 AYDRRIFARGSLTAALWAKSQIPGLYSMRDVLG 270
           AYDR IFA+G+L AA W K + PGLY+M+DVLG
Sbjct: 239 AYDRFIFAQGALEAARWIKGKAPGLYTMQDVLG 271


>gi|223940623|ref|ZP_03632466.1| Dihydrodipicolinate reductase [bacterium Ellin514]
 gi|223890704|gb|EEF57222.1| Dihydrodipicolinate reductase [bacterium Ellin514]
          Length = 244

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 140/258 (54%), Gaps = 25/258 (9%)

Query: 14  GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNLAMAIQSVD 73
           GRMG+ALI     NP +            + GQ            I   +NLA  I+  D
Sbjct: 11  GRMGKALIACAERNPEL-----------KVAGQ------------IDAGENLADVIKEAD 47

Query: 74  GIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKSSNMSLGIN 133
            +IDFS  A +     +SAQH    +IGTTG S  +   I S A   PIV ++N S G+N
Sbjct: 48  VVIDFSFHAASAGFAEVSAQHKKAIVIGTTGHSEADKAKIVSLASKIPIVLATNFSTGVN 107

Query: 134 FLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKVNLTDHMVL 193
            L +L   AAE L    D+D EI+EMHHR K D+PSGTA  L E +A+ RK+ L + +  
Sbjct: 108 TLFWLTRKAAEIL--GSDFDLEIVEMHHRLKKDAPSGTATTLAEILADVRKLQLKEALRH 165

Query: 194 NRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFARGSLTAAL 253
            R      RT   IG+ S+R G +VG+H+V+ A  GE + L+H A  R  FA G+L AA 
Sbjct: 166 GREGIVGERTASEIGMHSVRGGDVVGDHTVIFATNGERVELTHKASSRETFANGALRAAE 225

Query: 254 WAKSQIPGLYSMRDVLGI 271
           W   Q PGLY+M+DVLG+
Sbjct: 226 WVVKQKPGLYNMQDVLGL 243


>gi|317050247|ref|YP_004111363.1| dihydrodipicolinate reductase [Desulfurispirillum indicum S5]
 gi|316945331|gb|ADU64807.1| dihydrodipicolinate reductase [Desulfurispirillum indicum S5]
          Length = 267

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 149/267 (55%), Gaps = 3/267 (1%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++I+++G  GRMG  ++  +  +    L + I    SP +G+D G   G    GI  +D+
Sbjct: 2   LKIAIMGVTGRMGTTILNLVEKSDHCQLAAAIDAPTSPYLGKDSGEIAGFGTNGIVITDD 61

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L  A+   D +IDF+    T  +    A+  I  +IGTTG S +    I++ A++ PIV 
Sbjct: 62  LEAALSEADVVIDFTHADATAGNAPRLAKIGIPLVIGTTGLSAEGQAAINAAAQHIPIVF 121

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           + NMS G+N    L+E AA       D+D E++E HH RK D+PSGTA+ + + +A   K
Sbjct: 122 APNMSTGVNVTLKLLEMAATIF--GDDYDVEVVEAHHNRKKDAPSGTAMKMAQVLAQTLK 179

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
            +L    V +R      RT+  IGI ++R G IVG+H+V   G GE + ++H A+ R  F
Sbjct: 180 RDLATDAVYHREGMIGERTKKEIGIQTIRGGDIVGDHTVFFCGPGERVEITHRAHSRDTF 239

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVLGI 271
           A G++ AA W   Q  GLYSM DVLG+
Sbjct: 240 ASGAIRAATWVHHQPAGLYSMFDVLGL 266


>gi|222475334|ref|YP_002563751.1| dihydrodipicolinate reductase (dapB) [Anaplasma marginale str.
           Florida]
 gi|222419472|gb|ACM49495.1| dihydrodipicolinate reductase (dapB) [Anaplasma marginale str.
           Florida]
          Length = 314

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 152/265 (57%), Gaps = 11/265 (4%)

Query: 6   MRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           M+I ++G  GRMG+ +++E+     + L   +VR G+ L+G+D+G  +G    G K +D+
Sbjct: 58  MKIGIVGCLGRMGRIIVQEVVGTGGVELSGGVVRRGNGLVGEDMGAVLGCG-HGAKITDS 116

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
                   D +IDFSSP   L+ + I+++  +  + GTTG   ++     + A   P++ 
Sbjct: 117 KEFLFDCSDVVIDFSSPECMLECVGIASEKRVPLVSGTTGVDERD---FRTHAEKVPLLW 173

Query: 125 SSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRK 184
           S NMSLG+  L  LV+ AA      + +D EI E+HHR K D+PSGT+L+LG+A+A G  
Sbjct: 174 SCNMSLGVTLLLELVKMAAAGF---RGYDVEIRELHHRAKKDAPSGTSLMLGKAVAQGMG 230

Query: 185 VNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIF 244
           V L              R  G++G +  R G ++G+H+V+  G+ E + L H A DRR+F
Sbjct: 231 VELESQ---QHTFGFGCRRSGAVGFSVARGGGVIGDHAVMFLGDDEIVELQHRAIDRRVF 287

Query: 245 ARGSLTAALWAKSQIPGLYSMRDVL 269
           ARG++ AA W   +  GLY+M DVL
Sbjct: 288 ARGAIKAACWLVGKPAGLYTMLDVL 312


>gi|255066152|ref|ZP_05318007.1| dihydrodipicolinate reductase [Neisseria sicca ATCC 29256]
 gi|255049697|gb|EET45161.1| dihydrodipicolinate reductase [Neisseria sicca ATCC 29256]
          Length = 269

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 100/269 (37%), Positives = 153/269 (56%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           S ++I++ G  GRMG+ L++ ++N+P   L   +  SGS ++G D G   GI   GI  S
Sbjct: 2   SALKIAIAGVNGRMGRVLVEAVNNHPDTVLSGALEHSGSEVLGLDAGFASGIK-TGIAIS 60

Query: 63  DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPI 122
           D++   +   D +IDF+ P  TL+ L    +  +  IIGTTGF       I +      I
Sbjct: 61  DDVDAVLAQSDVLIDFTRPEPTLKHLQKCVEKGVNIIIGTTGFDDAGKAAIQAAGEKTGI 120

Query: 123 VKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANG 182
           V ++N S+G+N    +++  A  L   + +D EI+E HHR K+D+PSGTAL +GE IA+ 
Sbjct: 121 VFAANFSVGVNLTFHILDIVARVL--NEGYDIEIIEGHHRHKVDAPSGTALRMGEVIADA 178

Query: 183 RKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRR 242
              +L    V  R      R   +IG A++RAG IVG+H+ + A +GE + ++H A  R 
Sbjct: 179 LGRDLKQCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRM 238

Query: 243 IFARGSLTAALWAKSQIPGLYSMRDVLGI 271
            FA G++ AA+W   +  GLY M+DVLG+
Sbjct: 239 TFAAGAVRAAIWVNGK-TGLYDMQDVLGL 266


>gi|294789618|ref|ZP_06754852.1| dihydrodipicolinate reductase [Simonsiella muelleri ATCC 29453]
 gi|294482419|gb|EFG30112.1| dihydrodipicolinate reductase [Simonsiella muelleri ATCC 29453]
          Length = 271

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 152/266 (57%), Gaps = 4/266 (1%)

Query: 7   RISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDNL 65
           +I++ G  GRMG+ L++ +H NP  TL   +  + S ++G D G  VGI   GI  + + 
Sbjct: 6   KIAIAGVNGRMGKVLVQAVHANPHATLVGALEHAESDVLGLDAGYAVGIKT-GINITSDF 64

Query: 66  AMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVKS 125
             A+   D +IDF+ P  +L  +       I  +IGTTG++      I + A+   IV S
Sbjct: 65  QAALSDADVVIDFTRPEASLPLIAECESRGIKMVIGTTGYNDAGKNRIQAAAQKNAIVFS 124

Query: 126 SNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIANGRKV 185
           +N S+G+N    +++T A  L   + +D EI+E HHR K+D+PSGTAL +GE IAN    
Sbjct: 125 ANYSVGVNLTFHILDTVARVL--NEGYDIEIIEAHHRHKVDAPSGTALRMGEVIANALGR 182

Query: 186 NLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYDRRIFA 245
           +L    V  R     AR   +IG A++RAG IVG+H+ + A +GE + ++H A  R  FA
Sbjct: 183 DLKQCAVYGREGHTGARDPNTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRMTFA 242

Query: 246 RGSLTAALWAKSQIPGLYSMRDVLGI 271
            G++ AA+W   +  GL+ M+DVL +
Sbjct: 243 AGAVRAAVWLSEREVGLFDMQDVLDL 268


>gi|240015035|ref|ZP_04721948.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae DGI18]
 gi|240081624|ref|ZP_04726167.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae FA19]
 gi|240118860|ref|ZP_04732922.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID1]
 gi|240122103|ref|ZP_04735065.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID24-1]
 gi|240124397|ref|ZP_04737353.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID332]
 gi|240129074|ref|ZP_04741735.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae SK-93-1035]
 gi|268597718|ref|ZP_06131885.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae FA19]
 gi|268604566|ref|ZP_06138733.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID1]
 gi|268683023|ref|ZP_06149885.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID332]
 gi|268687451|ref|ZP_06154313.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae SK-93-1035]
 gi|268551506|gb|EEZ46525.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae FA19]
 gi|268588697|gb|EEZ53373.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID1]
 gi|268623307|gb|EEZ55707.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae PID332]
 gi|268627735|gb|EEZ60135.1| dihydrodipicolinate reductase [Neisseria gonorrhoeae SK-93-1035]
          Length = 269

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 155/269 (57%), Gaps = 5/269 (1%)

Query: 4   SPMRISVLGG-GRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFS 62
           +P+