RPSBLAST alignment for GI: 254780279 and conserved domain: pfam01113

>gnl|CDD|144632 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH. Length = 122
 Score =  122 bits (308), Expect = 1e-28
 Identities = 44/124 (35%), Positives = 73/124 (58%), Gaps = 3/124 (2%)

Query: 6   MRISVLG-GGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIKFSDN 64
           ++++V+G  GRMG+ LIK I   P   L + + R GS L+G D G   G  P+G+  +D+
Sbjct: 1   IKVAVVGASGRMGRELIKAILEAPDFELVAAVDRPGSSLLGSDAGELAG--PLGVPVTDD 58

Query: 65  LAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNAPIVK 124
           L   +   D +IDF++P  TL++L ++ +H    +IGTTGF+ ++   +   A+  PIV 
Sbjct: 59  LEEVLADADVLIDFTTPEATLENLELALKHGKPLVIGTTGFTEEQLAELKEAAKKIPIVI 118

Query: 125 SSNM 128
           + N 
Sbjct: 119 APNF 122