BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780279|ref|YP_003064692.1| dihydrodipicolinate reductase [Candidatus Liberibacter asiaticus str. psy62] (280 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780279|ref|YP_003064692.1| dihydrodipicolinate reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Score = 566 bits (1459), Expect = e-163, Method: Compositional matrix adjust. Identities = 280/280 (100%), Positives = 280/280 (100%) Query: 1 MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60 MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK Sbjct: 1 MHQSPMRISVLGGGRMGQALIKEIHNNPSITLHSIIVRSGSPLIGQDVGNFVGISPMGIK 60 Query: 61 FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120 FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA Sbjct: 61 FSDNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSFARNA 120 Query: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA Sbjct: 121 PIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEMHHRRKLDSPSGTALLLGEAIA 180 Query: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD Sbjct: 181 NGRKVNLTDHMVLNRHIQQCARTEGSIGIASLRAGSIVGEHSVVIAGEGESITLSHSAYD 240 Query: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE 280 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE Sbjct: 241 RRIFARGSLTAALWAKSQIPGLYSMRDVLGIGLDKEKINE 280 >gi|254780561|ref|YP_003064974.1| thiamine transporter substrate binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 338 Score = 27.3 bits (59), Expect = 0.30, Method: Compositional matrix adjust. Identities = 9/40 (22%), Positives = 23/40 (57%) Query: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEM 159 A +V+S L F+ F++ + + +LP +W + ++++ Sbjct: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDI 297 >gi|254780889|ref|YP_003065302.1| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 25.0 bits (53), Expect = 1.7, Method: Compositional matrix adjust. Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 39 SGSPLIGQDVGNFVGI-SPMGIKFSDNLAMAI 69 SG P++ DVG VGI + ++F+ N A+ Sbjct: 124 SGIPVVESDVGKLVGILTNRDVRFASNAQQAV 155 >gi|254780581|ref|YP_003064994.1| hypothetical protein CLIBASIA_02340 [Candidatus Liberibacter asiaticus str. psy62] Length = 33 Score = 23.9 bits (50), Expect = 3.1, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 131 GINFLGFLVETAAEYLLPAKDWDFE 155 G NF GFL + A + + A + DFE Sbjct: 3 GFNFCGFLPKRAGDLSMLAVENDFE 27 >gi|254780629|ref|YP_003065042.1| putative deoxyribonucleotide triphosphate pyrophosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 23.5 bits (49), Expect = 4.0, Method: Compositional matrix adjust. Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Query: 63 DNLAMAIQSVDGIIDFSSPALTLQSLNISAQHNIVHIIGTTGFSVKENEVISSF--ARNA 120 +N+ +A +VD I + S + L + SA + I TG S +EN +I S A+NA Sbjct: 7 NNIVIASHNVDKIHEMDSLIMPLGIMTTSALELNLIIPEETGNSFEENAMIKSLTAAKNA 66 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.135 0.382 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 174,837 Number of Sequences: 1233 Number of extensions: 6981 Number of successful extensions: 20 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 6 length of query: 280 length of database: 328,796 effective HSP length: 73 effective length of query: 207 effective length of database: 238,787 effective search space: 49428909 effective search space used: 49428909 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 38 (19.2 bits)