BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter asiaticus str. psy62] (201 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 405 bits (1040), Expect = e-115, Method: Compositional matrix adjust. Identities = 201/201 (100%), Positives = 201/201 (100%) Query: 1 MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60 MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI Sbjct: 1 MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI 60 Query: 61 VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120 VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR Sbjct: 61 VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR 120 Query: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK Sbjct: 121 IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK 180 Query: 181 DDSDSAIEKINRLITYGNVVK 201 DDSDSAIEKINRLITYGNVVK Sbjct: 181 DDSDSAIEKINRLITYGNVVK 201 >537021.9.peg.817_1 Length = 148 Score = 25.0 bits (53), Expect = 1.00, Method: Compositional matrix adjust. Identities = 9/32 (28%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 102 PKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133 P++DT + K ++RF+ + G+ G P+ +++ Sbjct: 52 PRKDTKSIAKALLKRFAT-LGGVFGAPLHLLQ 82 >gi|254781158|ref|YP_003065571.1| peptidyl prolyl cis-trans isomerase D signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 631 Score = 24.6 bits (52), Expect = 1.4, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 149 KSGVEEKYFVDHTTALL-LFDTAGSIVG 175 + G+ EK ++DH T +L D G VG Sbjct: 143 REGINEKEYIDHYTKMLSRTDVVGMFVG 170 >gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 144 Score = 22.7 bits (47), Expect = 5.1, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 88 PTGTLLNAYFITVD 101 P G LN YFI +D Sbjct: 98 PDGLQLNRYFIQID 111 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.140 0.398 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 130,774 Number of Sequences: 1233 Number of extensions: 5466 Number of successful extensions: 15 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 4 length of query: 201 length of database: 328,796 effective HSP length: 70 effective length of query: 131 effective length of database: 242,486 effective search space: 31765666 effective search space used: 31765666 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)