Query gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 623 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Tue May 24 12:17:13 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780284.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00998 8a0101 efflux pump m 70.3 4.8 0.00012 19.7 3.0 55 443-502 9-67 (379) 2 pfam05609 LAP1C Lamina-associa 54.2 4.6 0.00012 19.8 0.6 23 438-460 216-238 (465) 3 TIGR00727 ISP4_OPT small oligo 52.9 9.6 0.00025 17.8 2.0 33 440-473 27-59 (716) 4 COG1836 Predicted membrane pro 45.4 19 0.00047 16.1 2.5 28 434-462 34-61 (247) 5 pfam06864 PAP_PilO Pilin acces 43.2 23 0.00059 15.5 3.8 30 435-464 160-191 (414) 6 COG3242 Uncharacterized protei 40.6 16 0.0004 16.6 1.5 22 438-459 39-60 (62) 7 KOG4332 consensus 30.1 29 0.00074 14.9 1.5 194 342-578 243-449 (454) 8 TIGR00915 2A0602 RND transport 30.1 38 0.00096 14.2 2.6 67 433-506 534-602 (1058) 9 PRK07021 fliL flagellar basal 29.4 39 0.00099 14.1 2.4 26 438-463 11-39 (159) 10 PHA00497 pol RNA-dependent RNA 29.0 25 0.00063 15.3 1.0 44 247-291 386-430 (668) 11 PRK11106 queuosine biosynthesi 28.6 35 0.0009 14.4 1.7 42 149-190 129-172 (231) 12 pfam12294 DUF3626 Protein of u 27.6 20 0.00051 15.9 0.4 14 88-101 79-92 (297) 13 TIGR00364 TIGR00364 exsB prote 26.9 43 0.0011 13.9 2.4 66 125-190 92-185 (227) 14 TIGR00798 mtc tricarboxylate c 23.1 14 0.00036 16.8 -1.1 21 451-473 308-328 (344) 15 PRK12705 hypothetical protein; 21.5 54 0.0014 13.2 2.8 43 469-517 358-400 (485) 16 KOG4717 consensus 20.5 57 0.0015 13.1 1.7 15 478-492 596-610 (864) No 1 >TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds. EmrB encodes a highly hydrophobic 56.2-kDa peptide, with 14 potential alpha-helices to span the inner membrane. EmrA encodes a putative 42.7-kDa peptide containing a single hydrophobic domain and a large C-terminal hydrophilic domain.; GO: 0015238 drug transporter activity, 0006855 multidrug transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=70.27 E-value=4.8 Score=19.72 Aligned_cols=55 Identities=25% Similarity=0.395 Sum_probs=27.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEHHHHCCHHHHCC-CCC---CCCCCCHHHHHHH Q ss_conf 58899999844789998875320014678421031106254165-765---3223201899999 Q gi|254780284|r 443 LIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIP-SSS---EEENDTSFNQVHE 502 (623) Q Consensus 443 ligyilivvgcgiywffqlhreisfanekplivnaikdpmkvip-sss---eeendtsfnqvhe 502 (623) .+-.|++-+-||+|||+.+..-++ ..--.|+| |-|.|.| .-| -|-+-+.-++||+ T Consensus 9 vv~Li~~a~a~~~y~~~~~~~~~~---T~dAYV~a--~~~~v~sF~VsG~v~~v~~~d~d~Vk~ 67 (379) T TIGR00998 9 VVLLIVVALAYAIYWFLVLRDYES---TDDAYVKA--NQLQVSSFQVSGSVIEVNVDDTDYVKQ 67 (379) T ss_pred HHHHHHHHHHHHHHHHHHHHHCCC---HHHHHCCC--CCEEEEEEEEEEEEEEEEECCCCCCEE T ss_conf 999999999999999988740112---11462127--730232465732489997437884203 No 2 >pfam05609 LAP1C Lamina-associated polypeptide 1C (LAP1C). This family contains rat LAP1C proteins and several uncharacterized highly related sequences from both mice and humans. LAP1s (lamina-associated polypeptide 1s) are type 2 integral membrane proteins with a single membrane-spanning region of the inner nuclear membrane. LAP1s bind to both A- and B-type lamins and have a putative role in the membrane attachment and assembly of the nuclear lamina. Probab=54.24 E-value=4.6 Score=19.79 Aligned_cols=23 Identities=26% Similarity=0.817 Sum_probs=13.7 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 36303588999998447899988 Q gi|254780284|r 438 NRKFWLIGYILIVVGCGIYWFFQ 460 (623) Q Consensus 438 nrkfwligyilivvgcgiywffq 460 (623) ++|+|+.-.+.+++-+|++|||- T Consensus 216 k~k~~w~l~lia~l~~~v~~~~s 238 (465) T pfam05609 216 KKKGWWLLLLVAALASGVNWFFS 238 (465) T ss_pred HHHHHHHHHHHHHHHHCCCCCCC T ss_conf 45369999999999820244567 No 3 >TIGR00727 ISP4_OPT small oligopeptide transporter, OPT family; InterPro: IPR004648 Oligopeptide transporter OPT superfamily has two main branches. One branch contains a tetrapeptide transporter demonstrated experimentally in three different species of yeast. The other family contains EspB, a protein required for normal rather than delayed sporulation after cellular aggregation; its role is unknown but is compatible with transport of a signalling molecule. Homology between the two branches of the superfamily is seen most easily at the ends of the protein. The central regions are poorly conserved within each branch and may not be homologous between branches.. Probab=52.86 E-value=9.6 Score=17.84 Aligned_cols=33 Identities=33% Similarity=0.644 Sum_probs=26.7 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCE Q ss_conf 3035889999984478999887532001467842 Q gi|254780284|r 440 KFWLIGYILIVVGCGIYWFFQLHREISFANEKPL 473 (623) Q Consensus 440 kfwligyilivvgcgiywffqlhreisfanekpl 473 (623) +-|.||-|+-+||||.--||- ||..|++=.-+. T Consensus 27 Raw~iglI~s~vG~g~N~fFS-~r~ps~~l~t~i 59 (716) T TIGR00727 27 RAWVIGLIYSTVGSGVNMFFS-FRVPSISLNTLI 59 (716) T ss_pred HHHHHHHHHHHHHHHHHHHHH-CCCCEEEEHHHH T ss_conf 999999999988656642342-056405612789 No 4 >COG1836 Predicted membrane protein [Function unknown] Probab=45.42 E-value=19 Score=16.09 Aligned_cols=28 Identities=32% Similarity=0.570 Sum_probs=19.0 Q ss_pred HHHHCCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 45303630358899999844789998875 Q gi|254780284|r 434 DVAQNRKFWLIGYILIVVGCGIYWFFQLH 462 (623) Q Consensus 434 dvaqnrkfwligyilivvgcgiywffqlh 462 (623) |..-----|++|++ |++.||++||.-+- T Consensus 34 d~~G~~~A~~lG~~-i~~~~g~~~fllll 61 (247) T COG1836 34 DLSGSLSAILLGAL-IIVFGGFKWFLLLL 61 (247) T ss_pred CHHHHHHHHHHHHH-HHHHHHHHHHHHHH T ss_conf 84457999999999-99982279999999 No 5 >pfam06864 PAP_PilO Pilin accessory protein (PilO). This family consists of several enterobacterial PilO proteins. The function of PilO is unknown although it has been suggested that it is a cytoplasmic protein in the absence of other Pil proteins, but PilO protein is translocated to the outer membrane in the presence of other Pil proteins. Alternatively, PilO protein may form a complex with other Pil protein(s). PilO has been predicted to function as a component of the pilin transport apparatus and thin-pilus basal body. This family does not seem to be related to pfam04350. Probab=43.17 E-value=23 Score=15.50 Aligned_cols=30 Identities=23% Similarity=0.595 Sum_probs=18.5 Q ss_pred HHHCCCCHHHHHHHHHHH--HHHHHHHHHHHH Q ss_conf 530363035889999984--478999887532 Q gi|254780284|r 435 VAQNRKFWLIGYILIVVG--CGIYWFFQLHRE 464 (623) Q Consensus 435 vaqnrkfwligyilivvg--cgiywffqlhre 464 (623) +...+++++.+-+.++++ -+-||++|-|++ T Consensus 160 ~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~ 191 (414) T pfam06864 160 VSRGPQFILAGLLSLLAGTAWAVWQYWQRQQE 191 (414) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 54430699999999999999999999997678 No 6 >COG3242 Uncharacterized protein conserved in bacteria [Function unknown] Probab=40.55 E-value=16 Score=16.57 Aligned_cols=22 Identities=23% Similarity=0.415 Sum_probs=18.4 Q ss_pred CCCCHHHHHHHHHHHHHHHHHH Q ss_conf 3630358899999844789998 Q gi|254780284|r 438 NRKFWLIGYILIVVGCGIYWFF 459 (623) Q Consensus 438 nrkfwligyilivvgcgiywff 459 (623) .++.-++|--++++|++|||.+ T Consensus 39 d~~LR~~G~~~~~~G~~i~~~l 60 (62) T COG3242 39 DNQLRRFGGGLVVAGVVILYLL 60 (62) T ss_pred HHHHHHHHHHHHHHHHHHHHHH T ss_conf 8899997204898625763231 No 7 >KOG4332 consensus Probab=30.14 E-value=29 Score=14.90 Aligned_cols=194 Identities=26% Similarity=0.297 Sum_probs=83.7 Q ss_pred HHHHCHHHCCHHHHHHHHHHHHHHCCHHHCCEEEEECCCCCHHHHCCCCCC---CCCCCCHHH-HHHCCCCCCCCCCCCC Q ss_conf 763043340289845567532222012206604441176210010431156---665321011-2103357620012222 Q gi|254780284|r 342 SLLVDEEKLSLEKVNHSLEQDIATLSFEEGGKKYLFNSNTEGIARGISINR---DCSLGDDVH-RENMFSAPEISVDGFH 417 (623) Q Consensus 342 sllvdeeklslekvnhsleqdiatlsfeeggkkylfnsntegiargisinr---dcslgddvh-renmfsapeisvdgfh 417 (623) .++-||.-+-|.....-.|.-+-|.-|--. -....|.|+|..|+-... ..-||.... |----+ ...|..+| T Consensus 243 aiaSD~ki~LLG~iqsLFE~smytFVFLWT---PaLspn~e~iPhGfiFatFMlASmLGSSla~Rl~s~s--~~~ve~ym 317 (454) T KOG4332 243 AIASDEKIALLGAIQSLFEGSMYTFVFLWT---PALSPNDEEIPHGFIFATFMLASMLGSSLASRLLSRS--SPKVESYM 317 (454) T ss_pred HHHCCHHHHHHHHHHHHHHHHHHEEEEEEC---CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC--CCCCCHHH T ss_conf 874420889889999997421522456633---6679985568720089999999987368999987248--85542089 Q ss_pred CCCHHCCH------HHHC---CCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEHHHHCCHHHHCCCC Q ss_conf 55101013------4303---42024530363035889999984478999887532001467842103110625416576 Q gi|254780284|r 418 EGSSLVSP------ALKS---NSKRDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFANEKPLIVNAIKDPMKVIPSS 488 (623) Q Consensus 418 egsslvsp------alks---nskrdvaqnrkfwligyilivvgcgiywffqlhreisfanekplivnaikdpmkvipss 488 (623) .-+-+|+- .+.+ .+| ..--+-+||+.++-..||+||-- |+ |-.-++|| T Consensus 318 qivf~vs~a~l~Lpilt~~vsP~k----es~~~s~i~F~~~E~cvGlfwPS-----im------------kmRsqyIP-- 374 (454) T KOG4332 318 QIVFLVSIAALLLPILTSSVSPSK----ESPSESLIGFCLFEACVGLFWPS-----IM------------KMRSQYIP-- 374 (454) T ss_pred HHHHHHHHHHHHHHHHHHCCCCCC----CCCHHHHHHHHHHHHHHHHCCHH-----HH------------HHHHHHCC-- T ss_conf 999999999999999873347776----77068899999999998632267-----89------------99875187-- Q ss_pred CCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCC Q ss_conf 53223201899999997414889998112320010007665655564321125704666555666654100011233211 Q gi|254780284|r 489 SEEENDTSFNQVHEVYDRFSGEKPSSPKQKTLLNLQEKPIDFPVQNQETSHYKSPSIIENSIRDIQAVSQVSVAENEDRS 568 (623) Q Consensus 489 seeendtsfnqvhevydrfsgekpsspkqktllnlqekpidfpvqnqetshykspsiiensirdiqavsqvsvaenedrs 568 (623) ||+..|-.|-..--..-| ---.|+|+|.. +||..... .++-+|+.-- ..-|..+.-..|.|. |+. T Consensus 375 -EearstimNfFRvPLnif--------vClvLynlh~~--~~p~~tr~--mf~icS~~~~-~a~i~~~~L~~v~e~-d~~ 439 (454) T KOG4332 375 -EEARSTIMNFFRVPLNIF--------VCLVLYNLHVD--AFPTTTRN--MFGICSAFLF-VASILQRRLMTVVEH-DKE 439 (454) T ss_pred -HHHHHHHHHHEECHHHHH--------HHHHHEECCCC--CCCCCCCH--HHHHHHHHHH-HHHHHHHHHHHHHHC-CHH T ss_conf -777763565401303674--------34320001235--67566111--3301379999-999999887876204-174 Q ss_pred HHHEEEEHHC Q ss_conf 0000331000 Q gi|254780284|r 569 RSESIIVEKE 578 (623) Q Consensus 569 rsesiiveke 578 (623) |...--.||| T Consensus 440 ~~~~~~~ek~ 449 (454) T KOG4332 440 RRVPWSTEKE 449 (454) T ss_pred HCCCCCCCCC T ss_conf 2699986544 No 8 >TIGR00915 2A0602 RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family; InterPro: IPR004764 Hydrophobe/amphiphile efflux-1 HAE1 is involved in toxin production and resistance processes.; GO: 0005215 transporter activity, 0006810 transport, 0016021 integral to membrane. Probab=30.08 E-value=38 Score=14.21 Aligned_cols=67 Identities=21% Similarity=0.434 Sum_probs=42.5 Q ss_pred HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCEEHHHHCCHHHHCCCCCCCCCCCHHHHHHHHHHH Q ss_conf 245303630358899999844789998875320014--67842103110625416576532232018999999974 Q gi|254780284|r 433 RDVAQNRKFWLIGYILIVVGCGIYWFFQLHREISFA--NEKPLIVNAIKDPMKVIPSSSEEENDTSFNQVHEVYDR 506 (623) Q Consensus 433 rdvaqnrkfwligyilivvgcgiywffqlhreisfa--nekplivnaikdpmkvipssseeendtsfnqvhevydr 506 (623) +.+..++--||.=|+||++| .+|-|.++-. ||- ...-...-.|.-| +.+|.|..+.-.+||.+-|=. T Consensus 534 ~~~l~~~~r~l~~Y~ll~~g-~~~Lf~r~Pt--sFLP~EDQG~~~~~vQ~P----~G~t~e~T~~Vl~~v~~yll~ 602 (1058) T TIGR00915 534 GKILKRRLRYLLVYVLLVGG-MVFLFVRLPT--SFLPEEDQGVLMTIVQLP----AGATAERTQKVLAQVEKYLLA 602 (1058) T ss_pred HHHHHCCCCHHHHHHHHHHH-HHHHEEECCC--CCCCCCCCCEEEEEEECC----CCCCHHHHHHHHHHHHHHHHH T ss_conf 99860575043567778985-7642000774--448887860699999868----986557899999999999861 No 9 >PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed Probab=29.44 E-value=39 Score=14.15 Aligned_cols=26 Identities=27% Similarity=0.522 Sum_probs=13.8 Q ss_pred CCCCHHHHHHHH---HHHHHHHHHHHHHH Q ss_conf 363035889999---98447899988753 Q gi|254780284|r 438 NRKFWLIGYILI---VVGCGIYWFFQLHR 463 (623) Q Consensus 438 nrkfwligyili---vvgcgiywffqlhr 463 (623) .+|.|+|.-+++ ..|.|-||||-.+. T Consensus 11 kkkl~iii~~~~lll~~~g~g~~~~~~~~ 39 (159) T PRK07021 11 KKSIWLILLILITLAAAAGAGYSYWLSKQ 39 (159) T ss_pred CCEEEHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 76040589999999999999999995477 No 10 >PHA00497 pol RNA-dependent RNA polymerase Probab=28.98 E-value=25 Score=15.33 Aligned_cols=44 Identities=30% Similarity=0.391 Sum_probs=22.6 Q ss_pred HCCCCHHCCCCCCCCHHHHHCCCCCCCCCCCCCHHHHHHHHH-HHC Q ss_conf 118711117322237465403611232000655445566664-203 Q gi|254780284|r 247 EKSPVDDCGISLTESPKKRLGSHSAIDDDLGLDFGDIEKELL-SIS 291 (623) Q Consensus 247 ekspvddcgisltespkkrlgshsaidddlgldfgdiekell-sis 291 (623) -.+|+-|-|-.|--.|.| +...--..---|-+|+|+--.|| .|+ T Consensus 386 v~~~gPd~g~allGdpd~-~npql~~G~~SG~~fT~Lmg~l~~vi~ 430 (668) T PHA00497 386 VTAPGPDVGHALLGNPDK-YNPQLQVGLPSGSGFTDLMGALLMVIS 430 (668) T ss_pred ECCCCCCCCCCEECCHHH-CCCCCCCCCCCCCCHHHHHHHHHHHHH T ss_conf 238998866644168222-384221278664218899988987631 No 11 >PRK11106 queuosine biosynthesis protein QueC; Provisional Probab=28.60 E-value=35 Score=14.39 Aligned_cols=42 Identities=29% Similarity=0.434 Sum_probs=29.5 Q ss_pred CCCCCCCHHHHHHHHHHHHHHHHHC--CCCCCEEECCHHHHHCC Q ss_conf 3677761788841234588885200--33100110213556400 Q gi|254780284|r 149 IDYPDCDSEIMRGLDDDLDRCFEKK--DRTSAIQLDKTEEILKG 190 (623) Q Consensus 149 idypdcdseimrgldddldrcfekk--drtsaiqldkteeilkg 190 (623) -.||||-.|.+..+..-+..+.+++ =.|.-+.++|.|-+--| T Consensus 129 sgYPDCr~eFi~a~~~al~~g~~~~i~i~aPl~~l~K~eiv~l~ 172 (231) T PRK11106 129 SGYPDCRDEFVKALNHAVVLGMAKDIRFETPLMWLDKAETWALA 172 (231) T ss_pred CCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHH T ss_conf 88998989999999999985178981998377778888999999 No 12 >pfam12294 DUF3626 Protein of unknown function (DUF3626). This family of proteins is found in bacteria. Proteins in this family are typically between 294 and 374 amino acids in length. Probab=27.63 E-value=20 Score=15.89 Aligned_cols=14 Identities=36% Similarity=0.425 Sum_probs=9.8 Q ss_pred CCCCCCCCCCCCCC Q ss_conf 44547211432134 Q gi|254780284|r 88 SKHLSPRFGSAHEN 101 (623) Q Consensus 88 skhlsprfgsahen 101 (623) .---+|||||+|-- T Consensus 79 p~G~aPRFGS~~f~ 92 (297) T pfam12294 79 PDGPAPRFGSCYFL 92 (297) T ss_pred CCCCCCCCCCEEEE T ss_conf 88999976522566 No 13 >TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome. In Sinorhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA , . In Arthrobacter viscosus, the homologous gene is designated alu1 and is associated with an aluminum tolerance phenotype. When expressed in Escherichia coli, it conferred aliminium tolerance . The entry also contains the gene queC, which is responsible for the conversion of GTP to 7-cyano-7-deazaguanine (preQ0). The biosynthesis of hypermodified tRNA nucleoside queuosine only occurs in eubacteria. It occupies the wobble position for all known tRNAs that are specific for Asp, Asn, His or Tyr .. Probab=26.92 E-value=43 Score=13.87 Aligned_cols=66 Identities=29% Similarity=0.459 Sum_probs=42.6 Q ss_pred HHHHHCCCCCH-------HHHHHHHHHH-------------HHCCCCCCCCHHHHHHHHHHHHHH-HHHCCCCCCEE--- Q ss_conf 46653187512-------3566788777-------------530367776178884123458888-52003310011--- Q gi|254780284|r 125 DKSLQSKPSTD-------LLVQATSFLK-------------ESVIDYPDCDSEIMRGLDDDLDRC-FEKKDRTSAIQ--- 180 (623) Q Consensus 125 dkslqskpstd-------llvqatsflk-------------esvidypdcdseimrgldddldrc-fekkdrtsaiq--- 180 (623) ++.+..-|+|= +|--|.+|-. +----||||-.|-..-++.-|.-- ..+.=+-+.|| T Consensus 92 ~~~~E~~p~tfVPgRN~~fl~~a~~yA~~~gA~~v~~G~~~~DfSgYPDCr~EFvka~n~~l~Lgn~~~~v~i~Piql~a 171 (227) T TIGR00364 92 EKALETLPNTFVPGRNLIFLSLAASYAEALGAEAVITGVCETDFSGYPDCRDEFVKALNHALNLGNMLTPVEIRPIQLEA 171 (227) T ss_pred HHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEEC T ss_conf 35653113333780479999999998886184252200100036579888688999999999974126881120246666 Q ss_pred ----ECCHHHHHCC Q ss_conf ----0213556400 Q gi|254780284|r 181 ----LDKTEEILKG 190 (623) Q Consensus 181 ----ldkteeilkg 190 (623) |+|.|..-.| T Consensus 172 PL~~ltKaeiv~la 185 (227) T TIGR00364 172 PLMDLTKAEIVKLA 185 (227) T ss_pred CEEECCHHHHHHHH T ss_conf 70126989999998 No 14 >TIGR00798 mtc tricarboxylate carrier; InterPro: IPR004686 The MTC family consists of a limited number of homologues, all from eukaryotes. One member of the family has been functionally characterised as a tricarboxylate carrier from rat liver mitochondria. The rat liver mitochondrial tricarboxylate carrier has been reported to transport citrate, cis-aconitate, threo-D-isocitrate, D- and L-tartrate, malate, succinate and phosphoenolpyruvate. It presumably functions by a proton symport mechanism. The rest of the characterised proteins appear to be sideroflexins involved in iron transport.; GO: 0008324 cation transmembrane transporter activity, 0006812 cation transport, 0016020 membrane. Probab=23.10 E-value=14 Score=16.82 Aligned_cols=21 Identities=33% Similarity=0.575 Sum_probs=11.7 Q ss_pred HHHHHHHHHHHHHHHCCCCCCCE Q ss_conf 84478999887532001467842 Q gi|254780284|r 451 VGCGIYWFFQLHREISFANEKPL 473 (623) Q Consensus 451 vgcgiywffqlhreisfanekpl 473 (623) |-||+|++.+| |++|.+++.- T Consensus 308 vqCGlyyv~kL--E~~~~~~~~~ 328 (344) T TIGR00798 308 VQCGLYYVNKL--EPSLQQLIQK 328 (344) T ss_pred EEEEEHHHHHH--HHHHHHHHHH T ss_conf 44300212342--1889976430 No 15 >PRK12705 hypothetical protein; Provisional Probab=21.54 E-value=54 Score=13.24 Aligned_cols=43 Identities=23% Similarity=0.413 Sum_probs=28.9 Q ss_pred CCCCEEHHHHCCHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCHH Q ss_conf 6784210311062541657653223201899999997414889998112 Q gi|254780284|r 469 NEKPLIVNAIKDPMKVIPSSSEEENDTSFNQVHEVYDRFSGEKPSSPKQ 517 (623) Q Consensus 469 nekplivnaikdpmkvipssseeendtsfnqvhevydrfsgekpsspkq 517 (623) +|.|.++|||...-. +.+..|-..-.-.+-|..|+-.|..-.. T Consensus 358 ~e~~~VinaI~aHH~------d~~~~s~~a~lV~aADaiSaaRPGARre 400 (485) T PRK12705 358 NEPDYVVNAIASHHN------KVNPTTVYSVLVQIADALSAARPGARRE 400 (485) T ss_pred CCCHHHHHHHHHHCC------CCCCCCHHHHHHHHHHHHHCCCCCCCHH T ss_conf 988899999998379------8887458989999999985079973455 No 16 >KOG4717 consensus Probab=20.51 E-value=57 Score=13.11 Aligned_cols=15 Identities=33% Similarity=0.395 Sum_probs=7.5 Q ss_pred HCCHHHHCCCCCCCC Q ss_conf 106254165765322 Q gi|254780284|r 478 IKDPMKVIPSSSEEE 492 (623) Q Consensus 478 ikdpmkvipssseee 492 (623) -.|-..|.|+++-.. T Consensus 596 t~d~~~~ppgs~s~~ 610 (864) T KOG4717 596 TEDGSEVPPGSSSRH 610 (864) T ss_pred CCCCCCCCCCCCCCC T ss_conf 335664899864555 Done!