>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Leucyl tRNA synthetase (6.1.1.4 from EC) is an alpha monomer that belongs to class Ia. There are two different families of leucyl-tRNA synthetases. This family includes both archaeal and cytosolic eukaryotic leucyl-tRNA synthetases.; GO: 0000166 nucleotide binding, 0004823 leucine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006429 leucyl-tRNA aminoacylation, 0005737 cytoplasm.

Probab=96.15 E-value=0.0024 Score=42.47 Aligned_cols=141 Identities=21% Similarity=0.281 Sum_probs=81.4 Q ss_pred CCCCEEEECCHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCHH--HHHH Q ss_conf 34511531101101221100000122330245677777632112345554200012333447776532024436--7888 Q gi|254780285|r 378 KAQINVLLCELVRLYRDGMPIKMSKRAGDFITLRHVVDEVGSDSVRFMMLWRKNSELLDFDFCKVKEQSKENPV--FYVQ 455 (586) Q Consensus 378 ~~~~~~~~~~~v~l~~dg~~~kmstR~G~~v~l~dll~evg~~aiky~~L~~~~~~~~~Fd~d~~l~~~~~nt~--~Yiq 455 (586) T Consensus 722 WPr-Gi~vnG~~~L--eg~--KmSkSkGn~l~l~~~vekfGADv~Rl~~~~a-Ae~~~Dad~~~~e~--~-~~~~~L~~l 792 (1109) T TIGR00395 722 WPR-GIVVNGYVLL--EGK--KMSKSKGNVLTLKEAVEKFGADVARLYILDA-AELVQDADWKESEV--E-GTKKRLERL 792 (1109) T ss_pred CCC-EEEEEEEEEE--ECC--CCCCCCCCCHHHHHHHHHHCCHHHHHHHHHC-CCCCCCCCCCHHHH--H-HHHHHHHHH T ss_conf 976-1799757887--173--4054547622388999872761899999731-78721356106778--9-999999999 Q ss_pred HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH-HHHHHHHHHHHH Q ss_conf 8888899998753320024683223422355211499899999999842189999999852812799-999999998899 Q gi|254780285|r 456 YAYARCRSIFRQAKDIFPDLDFDLFPRNVIPQESEFDTSELQLIVHLAEYPRVIENATIAQEPYKLA-FYLYDLASVFHG 534 (586) Q Consensus 456 Ya~aR~~SIlrKa~~~~~~~~~~~~~~~~~~~~~~~~~~E~~L~~~l~~f~~vi~~a~~~~~P~~l~-~Yl~~La~~Fn~ 534 (586) T Consensus 793 ~~~a~e~~--~~~-------~GrPvl~e~GP-aE~~~f~D~wl~~~l~~~i~~~~e~~~~~~~r~A~~~~Lf~L~~d~~- 861 (1109) T TIGR00395 793 YEFAEEIT--KKS-------DGRPVLLEVGP-AEELSFIDRWLLSRLNKAIKEVTEAMENFQTRKAVKAALFDLKADVD- 861 (1109) T ss_pred HHHHHHHH--HHH-------CCCEEEECCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH- T ss_conf 99999985--430-------68401103577-76310521899999999999999999866678999999999999999- Q ss_pred HHHH Q ss_conf 9870 Q gi|254780285|r 535 HWSH 538 (586) Q Consensus 535 fY~~ 538 (586) T Consensus 862 ~Y~~ 865 (1109) T TIGR00395 862 WYRR 865 (1109) T ss_pred HHHH T ss_conf 9998

HHsearch alignment for GI: 254780285 and conserved domain: TIGR00395