>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . Valyl-tRNA synthetase (6.1.1.9 from EC) is an alpha monomer that belongs to class Ia.; GO: 0000166 nucleotide binding, 0004832 valine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006438 valyl-tRNA aminoacylation, 0005737 cytoplasm.

Probab=97.94 E-value=0.0013 Score=44.39 Aligned_cols=146 Identities=21% Similarity=0.308 Sum_probs=96.7 Q ss_pred CC--EECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCC-CCC Q ss_conf 41--000223443224411777778568999999998506664102014775314555678987532221024500-066 Q gi|254780285|r 121 TK--VNIEFVSANPTGPMHVGHCRCAVVGDTLASLMAFSGYEVTREYYINDAGAQINTLALSVFWRYQQALYNNDS-DLP 197 (586) Q Consensus 121 ~k--VvVE~sSpNp~KplHVGHlRsaiIGdsi~ril~~~G~~V~r~nyvgD~G~Q~~~li~~~~~~~~~~~~~~~~-~~~ 197 (586) T Consensus 35 ~~~~f~i~~PPPNvTG~LH~GHAl~~~l~D~l~RykRM~G~~vL---w----------------------~~G~DHAGIA 89 (970) T TIGR00422 35 EPKRFCIVIPPPNVTGSLHIGHALNWSLQDILARYKRMKGYNVL---W----------------------LPGTDHAGIA 89 (970) T ss_pred CCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCC---C----------------------CCCCCCCCCH T ss_conf 77751571782585555116689999999999985421787125---7----------------------8886657632 Q ss_pred HHHCCCCCHHHHHHHHHHHH--HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEECHHH-HHHCCHHHHH Q ss_conf 01102410000127888887--57641343023799999997899887545558870875210001588-7301045799 Q gi|254780285|r 198 EGYYPGVYLKHVGKELADKY--SSELLNFPEEKWLPIVKDYSVQAMMKIIRDDLKALNIQHDIFISEDD-FHRGDPSPIR 274 (586) Q Consensus 198 e~~~~~~y~~~~~~e~~~~~--~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~l~~l~i~fD~~~~Es~-~~~~~~~~i~ 274 (586) T Consensus 90 TQ---~~v----E~~~~~~~ikgK~k~D~gRe~F~~~~~ew-k~e~~~~I~~Q~~rLG~S~DW-srE~FTmd~~l~~~V~ 160 (970) T TIGR00422 90 TQ---VKV----EKKLKAEEIKGKTKHDLGREEFVEKIWEW-KEESGGTIKNQIKRLGVSLDW-SRERFTMDEGLSKAVK 160 (970) T ss_pred HH---HHH----HHHHHHHCCCCCCCCCCCHHHHHHHHHHH-HHHHHHHHHHHHHHCCCCCCC-CCCEEECCHHHHHHHH T ss_conf 46---899----99987622578877878868999999999-988779999999980885023-5004544888888999 Q ss_pred HHHHHHHHCCCCCCCC---CCCCCCCCCC Q ss_conf 9999999749851134---2675556542 Q gi|254780285|r 275 DIIDNLARQGYVYEGI---LPPPKSKTTQ 300 (586) Q Consensus 275 ~~i~~l~~~g~~~e~~---~~~~~~~~~~ 300 (586) T Consensus 161 ~~Fv~LY~~GLIYRg~~lVNWdpk~~TAi 189 (970) T TIGR00422 161 EAFVRLYEKGLIYRGEYLVNWDPKLNTAI 189 (970) T ss_pred HHHHHHHHCCCEEECCCCEEEECCCCCHH T ss_conf 99998855486154361137205446310

HHsearch alignment for GI: 254780285 and conserved domain: TIGR00422